Rabbit anti-Human RFC4 Polyclonal Antibody | anti-RFC4 antibody

RFC4 (Replication Factor C Subunit 4, Activator 1 Subunit 4, Replication Factor C 37kD Subunit, RF-C 37kD Subunit, RFC37, Activator 1 37kD Subunit, A1 37kD Subunit, MGC27291) (Biotin)

Cat. Num. AAA6392377

• Gene Names: RFC4; A1; RFC37
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RFC4; Polyclonal Antibody; RFC4 (Replication Factor C Subunit 4; Activator 1 Subunit 4; Replication Factor C 37kD Subunit; RF-C 37kD Subunit; RFC37; Activator 1 37kD Subunit; A1 37kD Subunit; MGC27291) (Biotin); anti-RFC4 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RFC4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-RFC4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human RFC4, aa1-363 (NP_002907.1).
• Immunogen Sequence: MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RFC4 rabbit polyclonal antibody. Western Blot analysis of RFC4 expression in human kidney.)

Western Blot (WB)

(RFC4 rabbit polyclonal antibody. Western Blot analysis of RFC4 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of RFC4 expression in transfected 293T cell line by RFC4 polyclonal antibody. Lane 1: RFC4 transfected lysate (39.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RFC4 antibody

The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36kD. RFC4 is the 37kD subunit. This subunit forms a core complex with the 36 and 40kD subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system.

Product Categories/Family for anti-RFC4 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4506491
• NCBI GeneID: 5984
• NCBI Accession #: NP_002907.1
• NCBI GenBank Nucleotide #: NM_002916
• Molecular Weight: 33,675 Da
• NCBI Official Full Name: replication factor C subunit 4
• NCBI Official Synonym Full Names: replication factor C (activator 1) 4, 37kDa
• NCBI Official Symbol: RFC4
• NCBI Official Synonym Symbols: A1; RFC37
• NCBI Protein Information: replication factor C subunit 4; A1 37 kDa subunit; RF-C 37 kDa subunit; RFC 37 kDa subunit; activator 1 37 kDa subunit; activator 1 subunit 4; replication factor C 37 kDa subunit
• Protein Family: Replication factor