Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: RELBSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Rabbit RELB Polyclonal Antibody | anti-RELB antibody

RELB antibody - C-terminal region

Gene Names
RELB; IREL; I-REL; IMD53; REL-B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
RELB; Polyclonal Antibody; RELB antibody - C-terminal region; anti-RELB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT
Sequence Length
579
Applicable Applications for anti-RELB antibody
Western Blot (WB)
Homology
Cow: 94%; Dog: 88%; Guinea Pig: 100%; Horse: 94%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RELB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: RELBSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: RELBSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: RELBSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RELBSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-RELB Antibody Titration: 1.25ug/mlPositive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-RELB Antibody Titration: 1.25ug/mlPositive Control: Transfected 293T)
Related Product Information for anti-RELB antibody
This is a rabbit polyclonal antibody against RELB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RELB neither associates with DNA nor with RELA/p65 or REL. It stimulates promoter activity in the presence of NFKB2/p49.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
transcription factor RelB
NCBI Official Synonym Full Names
RELB proto-oncogene, NF-kB subunit
NCBI Official Symbol
RELB
NCBI Official Synonym Symbols
IREL; I-REL; IMD53; REL-B
NCBI Protein Information
transcription factor RelB
UniProt Protein Name
Transcription factor RelB
Protein Family
UniProt Gene Name
RELB
UniProt Entry Name
RELB_HUMAN

Uniprot Description

RELB: a transcription factor of the nuclear factor-kappaB (NFkB) transcription complex. Stimulates promoter activity in the presence NFkB1/NFkB-p50. Plays role in regulation of apoptosis in hepatocellular carcinoma through activation of downstream target genes. Does not associate with DNA or RelA/NFkB-p65.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 19q13.32

Cellular Component: nucleoplasm; cytoplasm; microtubule organizing center; cytosol

Molecular Function: protein binding; chromatin binding; transcription corepressor activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; antigen processing and presentation; I-kappaB kinase/NF-kappaB cascade; response to cytokine stimulus; T-helper 1 cell differentiation; innate immune response; myeloid dendritic cell differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; circadian regulation of gene expression; inflammatory response

Research Articles on RELB

Similar Products

Product Notes

The RELB relb (Catalog #AAA3206948) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RELB antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RELB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RELB relb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GPEPLTLDSY QAPGPGDGGT ASLVGSNMFP NHYREAAFGG GLLSPGPEAT. It is sometimes possible for the material contained within the vial of "RELB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.