Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: REG4Sample Type: Thymus TumorAntibody Dilution: 1.0ug/ml)

Rabbit REG4 Polyclonal Antibody | anti-REG4 antibody

REG4 Antibody - C-terminal region

Gene Names
REG4; GISP; RELP; REG-IV
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
REG4; Polyclonal Antibody; REG4 Antibody - C-terminal region; anti-REG4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNN
Sequence Length
158
Applicable Applications for anti-REG4 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human REG4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: REG4Sample Type: Thymus TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: REG4Sample Type: Thymus TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-REG4 antibody
This is a rabbit polyclonal antibody against REG4. It was validated on Western Blot

Target Description: REG4 is a calcium-independent lectin displaying mannose-binding specificity and able to maintain carbohydrate recognition activity in an acidic environment. It may be involved in inflammatory and metaplastic responses of the gastrointestinal epithelium.
Product Categories/Family for anti-REG4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17 kDa
NCBI Official Full Name
regenerating islet-derived protein 4 isoform 1
NCBI Official Synonym Full Names
regenerating family member 4
NCBI Official Symbol
REG4
NCBI Official Synonym Symbols
GISP; RELP; REG-IV
NCBI Protein Information
regenerating islet-derived protein 4
UniProt Protein Name
Regenerating islet-derived protein 4
UniProt Gene Name
REG4
UniProt Synonym Gene Names
GISP; RELP; REG-4; Reg IV
UniProt Entry Name
REG4_HUMAN

Uniprot Description

REG4: Calcium-independent lectin displaying mannose-binding specificity and able to maintain carbohydrate recognition activity in an acidic environment. May be involved in inflammatory and metaplastic responses of the gastrointestinal epithelium. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1p13.1-p12

Cellular Component: cytoplasm; extracellular region

Molecular Function: heparin binding; calcium ion binding

Research Articles on REG4

Similar Products

Product Notes

The REG4 reg4 (Catalog #AAA3214851) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The REG4 Antibody - C-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's REG4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the REG4 reg4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSQPIWIGLH DPQKRQQWQW IDGAMYLYRS WSGKSMGGNK HCAEMSSNNN. It is sometimes possible for the material contained within the vial of "REG4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.