Western Blot (WB)
(WB Suggested Anti-REG3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Rabbit REG3A Polyclonal Antibody | anti-REG3A antibody
REG3A antibody - N-terminal region
Gene Names
REG3A; HIP; PAP; PAP1; REG3; INGAP; PAP-H; PBCGF; HIP/PAP; REG-III
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
REG3A; Polyclonal Antibody; REG3A antibody - N-terminal region; anti-REG3A antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLV
Sequence Length
175
Applicable Applications for anti-REG3A antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human REG3A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-REG3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-REG3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Related Product Information for anti-REG3A antibody
This is a rabbit polyclonal antibody against REG3A. It was validated on Western Blot
Target Description: This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. Alternate splicing results in multiple transcript variants that encode the same protein.
Target Description: This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. Alternate splicing results in multiple transcript variants that encode the same protein.
Product Categories/Family for anti-REG3A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
regenerating islet-derived protein 3-alpha
NCBI Official Synonym Full Names
regenerating family member 3 alpha
NCBI Official Symbol
REG3A
NCBI Official Synonym Symbols
HIP; PAP; PAP1; REG3; INGAP; PAP-H; PBCGF; HIP/PAP; REG-III
NCBI Protein Information
regenerating islet-derived protein 3-alpha
UniProt Protein Name
Regenerating islet-derived protein 3-alpha
Protein Family
UniProt Gene Name
REG3A
UniProt Synonym Gene Names
HIP; PAP; PAP1; REG-3-alpha; HIP/PAP
UniProt Entry Name
REG3A_HUMAN
NCBI Description
This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. The mature protein also functions as an antimicrobial protein with antibacterial activity. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, Nov 2014]
Uniprot Description
REG3A: Might be a stress protein involved in the control of bacterial proliferation.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 2p12
Cellular Component: extracellular space; cytoplasm
Molecular Function: carbohydrate binding
Biological Process: heterophilic cell adhesion; cell proliferation; multicellular organismal development; negative regulation of keratinocyte differentiation; acute-phase response
Research Articles on REG3A
Similar Products
Product Notes
The REG3A reg3a (Catalog #AAA3210235) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The REG3A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's REG3A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the REG3A reg3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSKAYGSHCY ALFLSPKSWT DADLACQKRP SGNLVSVLSG AEGSFVSSLV. It is sometimes possible for the material contained within the vial of "REG3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
