Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Muscle )

Rabbit RCE1 Polyclonal Antibody | anti-RCE1 antibody

RCE1 Antibody - N-terminal region

Gene Names
RCE1; FACE2; RCE1A; RCE1B
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
RCE1; Polyclonal Antibody; RCE1 Antibody - N-terminal region; anti-RCE1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF
Sequence Length
329
Applicable Applications for anti-RCE1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RCE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Muscle )

Immunohistochemistry (IHC) (Human Muscle )

Western Blot (WB)

(WB Suggested Anti-RCE1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateRCE1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-RCE1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateRCE1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-RCE1 antibody
This is a rabbit polyclonal antibody against RCE1. It was validated on Western Blot and immunohistochemistry

Target Description: This gene encodes an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins.
Product Categories/Family for anti-RCE1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
CAAX prenyl protease 2 isoform 1
NCBI Official Synonym Full Names
Ras converting CAAX endopeptidase 1
NCBI Official Symbol
RCE1
NCBI Official Synonym Symbols
FACE2; RCE1A; RCE1B
NCBI Protein Information
CAAX prenyl protease 2
UniProt Protein Name
CAAX prenyl protease 2
UniProt Gene Name
RCE1
UniProt Synonym Gene Names
FACE2; RCE1A; RCE1B; FACE-2; hRCE1
UniProt Entry Name
FACE2_HUMAN

NCBI Description

This gene encodes an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

RCE1: Proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. Seems to be able to process K-Ras, N-Ras, H-Ras, RAP1B and G-gamma-1. Belongs to the peptidase U48 family.

Protein type: EC 3.4.22.-; Membrane protein, multi-pass; Membrane protein, integral; Protease

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane; integral to plasma membrane; membrane

Molecular Function: cysteine-type endopeptidase activity; endopeptidase activity; metalloendopeptidase activity

Biological Process: proteolysis

Research Articles on RCE1

Similar Products

Product Notes

The RCE1 rce1 (Catalog #AAA3207530) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RCE1 Antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RCE1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the RCE1 rce1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WARCLTDMRW LRNQVIAPLT EELVFRACML PMLAPCMGLG PAVFTCPLFF. It is sometimes possible for the material contained within the vial of "RCE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.