Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RCAN2Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit RCAN2 Polyclonal Antibody | anti-RCAN2 antibody

RCAN2 Antibody - middle region

Gene Names
RCAN2; CSP2; RCN2; MCIP2; ZAKI4; ZAKI-4; DSCR1L1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RCAN2; Polyclonal Antibody; RCAN2 Antibody - middle region; anti-RCAN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPE
Sequence Length
243
Applicable Applications for anti-RCAN2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 86%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of HUMAN RCAN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RCAN2Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RCAN2Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RCAN2 antibody
This is a rabbit polyclonal antibody against RCAN2. It was validated on Western Blot

Target Description: RCAN2 inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. RCAN2 could play a role during central nervous system development.
Product Categories/Family for anti-RCAN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
calcipressin-2 isoform 2
NCBI Official Synonym Full Names
regulator of calcineurin 2
NCBI Official Symbol
RCAN2
NCBI Official Synonym Symbols
CSP2; RCN2; MCIP2; ZAKI4; ZAKI-4; DSCR1L1
NCBI Protein Information
calcipressin-2
UniProt Protein Name
Calcipressin-2
Protein Family
UniProt Gene Name
RCAN2
UniProt Synonym Gene Names
DSCR1L1; ZAKI4; MCIP2
UniProt Entry Name
RCAN2_HUMAN

NCBI Description

This gene encodes a member of the regulator of calcineurin (RCAN) protein family. These proteins play a role in many physiological processes by binding to the catalytic domain of calcineurin A, inhibiting calcineurin-mediated nuclear translocation of the transcription factor NFATC1. Expression of this gene in skin fibroblasts is upregulated by thyroid hormone, and the encoded protein may also play a role in endothelial cell function and angiogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

RCAN2: Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Could play a role during central nervous system development. Belongs to the RCAN family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 6p12.3

Molecular Function: nucleotide binding

Biological Process: calcineurin-NFAT signaling pathway; short-term memory; response to oxidative stress; locomotion during locomotory behavior

Research Articles on RCAN2

Similar Products

Product Notes

The RCAN2 rcan2 (Catalog #AAA3210611) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RCAN2 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RCAN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RCAN2 rcan2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VTFQLFKSFR RVRINFSNPK SAARARIELH ETQFRGKKLK LYFAQVQTPE. It is sometimes possible for the material contained within the vial of "RCAN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.