Rabbit anti-Human, Mouse RBM39 Polyclonal Antibody | anti-RBM39 antibody

RBM39 Polyclonal Antibody

Cat. Num. AAA9140483

• Gene Names: RBM39; HCC1; CAPER; RNPC2; FSAP59; CAPERalpha
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: RBM39; Polyclonal Antibody; RBM39 Polyclonal Antibody; CAPER; CAPERalpha; FSAP59; HCC1; RNPC2; RNA-binding protein 39; anti-RBM39 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 1.33 mg/ml (varies by lot)
• Sequence Length: 508

• Applicable Applications for anti-RBM39 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human RBM39 (NP_001229528.1).
• Immunogen Sequence: ATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR
• Positive Samples: BxPC-3, U-251MG, 293T, LO2, Mouse Brain, Mouse Heart
• Cellular Location: Nucleus Speckle
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-RBM39 Polyclonal Antibody)

Related Product Information for anti-RBM39 antibody

This gene encodes a member of the U2AF65 family of proteins. The encoded protein is found in the nucleus, where it co-localizes with core spliceosomal proteins. It has been shown to play a role in both steroid hormone receptor-mediated transcription and alternative splicing, and it is also a transcriptional coregulator of the viral oncoprotein v-Rel. Multiple transcript variants have been observed for this gene. A related pseudogene has been identified on chromosome X.

NCBI and Uniprot Product Information

• NCBI GI #: 336176064
• NCBI GeneID: 9584
• NCBI Accession #: NP_001229528.1
• NCBI GenBank Nucleotide #: NP_001229528.1
• UniProt Accession #: Q14498
• Molecular Weight: Calculated: 57kDa; 58kDa; 59kDa; Observed: 70kDa
• NCBI Official Full Name: RNA-binding protein 39 isoform c
• NCBI Official Synonym Full Names: RNA binding motif protein 39
• NCBI Official Symbol: RBM39
• NCBI Official Synonym Symbols: HCC1; CAPER; RNPC2; FSAP59; CAPERalpha
• NCBI Protein Information: RNA-binding protein 39
• UniProt Protein Name: RNA-binding protein 39
• Protein Family: RNA-binding protein
• UniProt Gene Name: RBM39
• UniProt Synonym Gene Names: HCC1; RNPC2
• UniProt Entry Name: RBM39_HUMAN

NCBI Description

This gene encodes a member of the U2AF65 family of proteins. The encoded protein is found in the nucleus, where it co-localizes with core spliceosomal proteins. It has been shown to play a role in both steroid hormone receptor-mediated transcription and alternative splicing, and it is also a transcriptional coregulator of the viral oncoprotein v-Rel. Multiple transcript variants have been observed for this gene. A related pseudogene has been identified on chromosome X. [provided by RefSeq, Aug 2011]

Uniprot Description

RNPC2: Transcriptional coactivator for steroid nuclear receptors ESR1/ER-alpha and ESR2/ER-beta, and JUN/AP-1. May be involved in pre-mRNA splicing process. Belongs to the splicing factor SR family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; RNA-binding; Spliceosome

Chromosomal Location of Human Ortholog: 20q11.22

Cellular Component: microtubule cytoskeleton; nucleoplasm; microtubule organizing center; nuclear speck

Molecular Function: protein binding; nucleotide binding

Biological Process: RNA processing; regulation of transcription, DNA-dependent; transcription, DNA-dependent; RNA splicing; mRNA processing