Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-RB1CC1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Peripheral membranePrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit RB1CC1 Polyclonal Antibody | anti-RB1CC1 antibody

RB1CC1 antibody - C-terminal region

Gene Names
RB1CC1; CC1; ATG17; FIP200; PPP1R131
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
RB1CC1; Polyclonal Antibody; RB1CC1 antibody - C-terminal region; anti-RB1CC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
Sequence Length
1591
Applicable Applications for anti-RB1CC1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RB1CC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-RB1CC1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Peripheral membranePrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-RB1CC1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Peripheral membranePrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-RB1CC1 Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysateRB1CC1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (WB Suggested Anti-RB1CC1 Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysateRB1CC1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-RB1CC1 antibody
This is a rabbit polyclonal antibody against RB1CC1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RB1CC1 is implicated in the regulation of RB1 expression. It functions as a DNA-binding transcription factor. RB1CC1 is a potent regulator of the RB1 pathway and a mediator that plays a crucial role in muscular differentiation. The expression of RB1CC1 is, thus, a prerequisite for myogenic differentiation. RB1CC1 is frequently mutated in breast cancer and shows characteristics of a classical tumor suppressor gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
183kDa
NCBI Official Full Name
RB1-inducible coiled-coil protein 1 isoform 2
NCBI Official Synonym Full Names
RB1 inducible coiled-coil 1
NCBI Official Symbol
RB1CC1
NCBI Official Synonym Symbols
CC1; ATG17; FIP200; PPP1R131
NCBI Protein Information
RB1-inducible coiled-coil protein 1
UniProt Protein Name
RB1-inducible coiled-coil protein 1
UniProt Gene Name
RB1CC1
UniProt Synonym Gene Names
KIAA0203; RBICC; FIP200
UniProt Entry Name
RBCC1_HUMAN

NCBI Description

The protein encoded by this gene interacts with signaling pathways to coordinately regulate cell growth, cell proliferation, apoptosis, autophagy, and cell migration. This tumor suppressor also enhances retinoblastoma 1 gene expression in cancer cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2009]

Uniprot Description

RB1CC1: a putative transcription factor that functions as a key regulator of Rb expression. Required for autophagosome formation. Contains a nuclear localization signal, a leucine zipper motif and a coiled-coil structure. Thought to play a biological role in controlling cell growth and progression of various cancers. Probably involved in the tumorigenesis of breast cancer. It is frequently mutated in breast cancer and shows characteristics of a classical tumor suppressor gene. Plays a crucial role in muscular differentiation and required for myogenic differentiation. Part of a complex consisting of ATG13, ULK1 and RB1CC1. This complex associates with ATG101. Under starvation conditions, is localized to phagophores. Expression levels correlated closely with those of RB1 in cancer cell lines as well as in various normal human tissues. Abundantly expressed in human musculoskeletal and cultured osteosarcoma cells. Expression was difficult to detect in immature proliferating chondroblasts or myogenic cells in embryos, but became obvious and prominent concomitantly with the maturation of osteocytes, chondrocytes, and skeletal muscle cells. Expression in these musculoskeletal cells increased with RB1 expression, which is linked to the terminal differentiation of many tissues and cells. The introduction of the wild-type protein decreased the formation of macroscopic colonies in a cell growth assay.

Protein type: DNA-binding; Autophagy; Tumor suppressor; Transcription factor

Chromosomal Location of Human Ortholog: 8q11

Cellular Component: nuclear membrane; cytoplasm; pre-autophagosomal structure membrane; cytosol

Molecular Function: protein binding; protein kinase binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of cell size; heart development; JNK cascade; regulation of autophagy; positive regulation of protein amino acid phosphorylation; liver development; cell cycle; autophagic vacuole formation

Disease: Breast Cancer

Research Articles on RB1CC1

Similar Products

Product Notes

The RB1CC1 rb1cc1 (Catalog #AAA3209949) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RB1CC1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RB1CC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the RB1CC1 rb1cc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGASRRPWVL GKVMEKEYCQ AKKAQNRFKV PLGTKFYRVK AVSWNKKV. It is sometimes possible for the material contained within the vial of "RB1CC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.