Western Blot (WB)
(RASL10A antibody (MBS839486) used at 1 ug/ml to detect target protein.)
Rabbit RASL10A Polyclonal Antibody | anti-RASL10A antibody
RASL10A antibody
Gene Names
rasl10a; rrp22
Applications
Western Blot
Purity
Affinity purified
Synonyms
RASL10A; Polyclonal Antibody; RASL10A antibody; Polyclonal RASL10A; Anti-RASL10A; Ras-Like Family 10 Member A; RASL-10; RASL 10; RRP22; RASL10; anti-RASL10A antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
RASL10A antibody was raised against the N terminal of RASL10A
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RASL10A antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
199
Applicable Applications for anti-RASL10A antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The specific function of RASL10A is not yet known.
Cross-Reactivity
Human
Immunogen
RASL10A antibody was raised using the N terminal of RASL10A corresponding to a region with amino acids PTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQ
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(RASL10A antibody (MBS839486) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(RASL10A antibody (MBS839486) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-RASL10A antibody
Rabbit polyclonal RASL10A antibody raised against the N terminal of RASL10A
Product Categories/Family for anti-RASL10A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22 kDa (MW of target protein)
NCBI Official Full Name
ras-like protein family member 10A
NCBI Official Synonym Full Names
RAS-like, family 10, member A
NCBI Official Symbol
rasl10a
NCBI Official Synonym Symbols
rrp22
NCBI Protein Information
ras-like protein family member 10A
Protein Family
Similar Products
Product Notes
The RASL10A (Catalog #AAA839486) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RASL10A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the RASL10A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RASL10A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
