Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RHESSample Type: Lung TumorAntibody Dilution: 1.0ug/ml)

Rabbit RASD2 Polyclonal Antibody | anti-RASD2 antibody

RASD2 Antibody - C-terminal region

Gene Names
RASD2; Rhes; TEM2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
RASD2; Polyclonal Antibody; RASD2 Antibody - C-terminal region; anti-RASD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCT
Sequence Length
266
Applicable Applications for anti-RASD2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen for Anti-RASD2 antibody is: synthetic peptide directed towards the C-terminal region of Human RHES
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RHESSample Type: Lung TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RHESSample Type: Lung TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RASD2 antibody
This is a rabbit polyclonal antibody against RHES. It was validated on Western Blot

Target Description: This gene encodes a Ras-related protein that enriched in striatum. The product of this gene binds to GTP and possesses intrinsic GTPase activity. The gene belongs to the Ras superfamily of small GTPases. The exact function of this gene is unknown, but most striatum-specific mRNAs characterized to date encode components of signal transduction cascades.
Product Categories/Family for anti-RASD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29 kDa
NCBI Official Synonym Full Names
RASD family member 2
NCBI Official Symbol
RASD2
NCBI Official Synonym Symbols
Rhes; TEM2
NCBI Protein Information
GTP-binding protein Rhes
UniProt Protein Name
GTP-binding protein Rhes
Protein Family
UniProt Gene Name
RASD2
UniProt Synonym Gene Names
TEM2
UniProt Entry Name
RHES_HUMAN

NCBI Description

This gene belongs to the Ras superfamily of small GTPases and is enriched in the striatum. The encoded protein functions as an E3 ligase for attachment of small ubiquitin-like modifier (SUMO). This protein also binds to mutant huntingtin (mHtt), the protein mutated in Huntington disease (HD). Sumoylation of mHTT by this protein may cause degeneration of the striatum. The protein functions as an activator of mechanistic target of rapamycin 1 (mTOR1), which in turn plays a role in myelination, axon growth and regeneration. Reduced levels of mRNA expressed by this gene were found in HD patients. [provided by RefSeq, Jan 2016]

Uniprot Description

RASD2: GTPase signaling protein that binds to and hydrolyzes GTP. Regulates signaling pathways involving G-proteins-coupled receptor and heterotrimeric proteins such as GNB1, GNB2 and GNB3. May be involved in selected striatal competencies, mainly locomotor activity and motor coordination. Belongs to the small GTPase superfamily. RasD family.

Protein type: G protein, monomeric, RasD; G protein, monomeric; G protein

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: plasma membrane

Molecular Function: GTPase activity; GTP binding; ubiquitin conjugating enzyme binding; G-protein beta-subunit binding

Biological Process: positive regulation of protein sumoylation; positive regulation of protein kinase B signaling cascade; synaptic transmission, dopaminergic; metabolic process; small GTPase mediated signal transduction; locomotory behavior; negative regulation of protein ubiquitination

Research Articles on RASD2

Similar Products

Product Notes

The RASD2 rasd2 (Catalog #AAA3214944) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RASD2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RASD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RASD2 rasd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RPFCMRRVKE MDAYGMVSPF ARRPSVNSDL KYIKAKVLRE GQARERDKCT. It is sometimes possible for the material contained within the vial of "RASD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.