Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RPGF5Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human RAPGEF5 Polyclonal Antibody | anti-RAPGEF5 antibody

RAPGEF5 Antibody - middle region

Gene Names
RAPGEF5; GFR; REPAC; MR-GEF
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RAPGEF5; Polyclonal Antibody; RAPGEF5 Antibody - middle region; anti-RAPGEF5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GMHRRHTVDEYSPQKKNKALFHQFSLKENWLQHRGTVTETEEIFCHVYIT
Sequence Length
444
Applicable Applications for anti-RAPGEF5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human RPGF5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RPGF5Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RPGF5Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RAPGEF5 antibody
This is a rabbit polyclonal antibody against RPGF5. It was validated on Western Blot

Target Description: Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RAPGEF5, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM, Mar 2008]
Product Categories/Family for anti-RAPGEF5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
rap guanine nucleotide exchange factor 5
NCBI Official Synonym Full Names
Rap guanine nucleotide exchange factor 5
NCBI Official Symbol
RAPGEF5
NCBI Official Synonym Symbols
GFR; REPAC; MR-GEF
NCBI Protein Information
rap guanine nucleotide exchange factor 5
UniProt Protein Name
Rap guanine nucleotide exchange factor 5
UniProt Gene Name
RAPGEF5
UniProt Synonym Gene Names
GFR; KIAA0277; MRGEF; MR-GEF; Repac
UniProt Entry Name
RPGF5_HUMAN

NCBI Description

Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RAPGEF5, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM, Mar 2008]

Uniprot Description

RAPGEF5: Guanine nucleotide exchange factor (GEF) for RAP1A, RAP2A and MRAS/M-Ras-GTP. Its association with MRAS inhibits Rap1 activation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs; GAPs, Ras

Chromosomal Location of Human Ortholog: 7p15.3

Cellular Component: nucleus

Molecular Function: Rap guanyl-nucleotide exchange factor activity; GTP-dependent protein binding; Ras guanyl-nucleotide exchange factor activity

Biological Process: nervous system development; small GTPase mediated signal transduction

Research Articles on RAPGEF5

Similar Products

Product Notes

The RAPGEF5 rapgef5 (Catalog #AAA3219977) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAPGEF5 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAPGEF5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAPGEF5 rapgef5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GMHRRHTVDE YSPQKKNKAL FHQFSLKENW LQHRGTVTET EEIFCHVYIT. It is sometimes possible for the material contained within the vial of "RAPGEF5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.