Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RAD54B rabbit polyclonal antibody. Western Blot analysis of RAD54B expression in human stomach.)

Rabbit anti-Human RAD54B Polyclonal Antibody | anti-RAD54B antibody

RAD54B (DNA Replication, Repair and Recombination Factor) (PE)

Gene Names
RAD54B; RDH54
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAD54B; Polyclonal Antibody; RAD54B (DNA Replication; Repair and Recombination Factor) (PE); anti-RAD54B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RAD54B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RAD54B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RAD54B, aa1-158 (AAH33710.2).
Immunogen Sequence
MLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RAD54B rabbit polyclonal antibody. Western Blot analysis of RAD54B expression in human stomach.)

Western Blot (WB) (RAD54B rabbit polyclonal antibody. Western Blot analysis of RAD54B expression in human stomach.)

Western Blot (WB)

(Western Blot analysis of RAD54B expression in transfected 293T cell line by RAD54B polyclonal antibody. Lane 1: RAD54B transfected lysate (18.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RAD54B expression in transfected 293T cell line by RAD54B polyclonal antibody. Lane 1: RAD54B transfected lysate (18.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RAD54B antibody
The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer. [provided by RefSeq]
Product Categories/Family for anti-RAD54B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
13,330 Da
NCBI Official Full Name
Homo sapiens RAD54 homolog B (S. cerevisiae), mRNA
NCBI Official Synonym Full Names
RAD54 homolog B (S. cerevisiae)
NCBI Official Symbol
RAD54B
NCBI Official Synonym Symbols
RDH54
NCBI Protein Information
DNA repair and recombination protein RAD54B

NCBI Description

The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer. [provided by RefSeq, Jul 2008]

Research Articles on RAD54B

Similar Products

Product Notes

The RAD54B (Catalog #AAA6391901) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAD54B (DNA Replication, Repair and Recombination Factor) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAD54B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAD54B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAD54B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.