Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human RAD51L1 Polyclonal Antibody | anti-RAD51L1 antibody

RAD51L1 (RAD51-like 1 (S. cerevisiae), MGC34245, R51H2, RAD51B, REC2, hREC2) (MaxLight 490)

Gene Names
RAD51B; REC2; R51H2; RAD51L1
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
RAD51L1; Polyclonal Antibody; RAD51L1 (RAD51-like 1 (S. cerevisiae); MGC34245; R51H2; RAD51B; REC2; hREC2) (MaxLight 490); RAD51-like 1 (S. cerevisiae); hREC2; anti-RAD51L1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RAD51L1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
384
Applicable Applications for anti-RAD51L1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RAD51L1 (NP_598193.2, 1aa-384aa) full-length human protein.
Immunogen Sequence
MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF
Conjugate
MaxLight490
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-RAD51L1 antibody
The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]
Product Categories/Family for anti-RAD51L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
DNA repair protein RAD51 homolog 2 isoform 3
NCBI Official Synonym Full Names
RAD51 paralog B
NCBI Official Symbol
RAD51B
NCBI Official Synonym Symbols
REC2; R51H2; RAD51L1
NCBI Protein Information
DNA repair protein RAD51 homolog 2
UniProt Protein Name
DNA repair protein RAD51 homolog 2
UniProt Gene Name
RAD51B
UniProt Synonym Gene Names
RAD51L1; REC2; R51H2; Rad51B
UniProt Entry Name
RA51B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. Rearrangements between this locus and high mobility group AT-hook 2 (HMGA2, GeneID 8091) have been observed in uterine leiomyomata. [provided by RefSeq, Mar 2016]

Uniprot Description

RAD51L1: Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. May promote the assembly of presynaptic RAD51 nucleoprotein filaments. The RAD51B- RAD51C dimer exhibits single-stranded DNA-dependent ATPase activity. The BCDX2 complex binds single-stranded DNA, single- stranded gaps in duplex DNA and specifically to nicks in duplex DNA. A chromosomal aberration involving RAD51B is found in pulmonary chondroid hamartoma. Translocation t(6;14)(p21;q23- 24) with HMGA1. A chromosomal aberration involving RAD51B is found in uterine leiomyoma. Translocation t(12;14)(q15;q23-24) with HMGA2. Belongs to the RecA family. RAD51 subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 14q23-q24.2

Cellular Component: nucleoplasm; replication fork; nucleus

Molecular Function: DNA-dependent ATPase activity; protein binding; DNA binding; four-way junction DNA binding; double-stranded DNA binding; single-stranded DNA binding; ATP binding

Biological Process: meiotic recombination; blood coagulation; DNA repair; double-strand break repair via homologous recombination; DNA recombination

Disease: Leiomyoma, Uterine

Research Articles on RAD51L1

Similar Products

Product Notes

The RAD51L1 rad51b (Catalog #AAA6451526) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAD51L1 (RAD51-like 1 (S. cerevisiae), MGC34245, R51H2, RAD51B, REC2, hREC2) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAD51L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAD51L1 rad51b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAD51L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.