Rabbit anti-Human RAD51L1 Polyclonal Antibody | anti-RAD51L1 antibody

RAD51L1 (RAD51-like 1 (S. cerevisiae), MGC34245, R51H2, RAD51B, REC2, hREC2) (FITC)

Cat. Num. AAA6451523

• Gene Names: RAD51B; REC2; R51H2; RAD51L1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified
• Synonyms: RAD51L1; Polyclonal Antibody; RAD51L1 (RAD51-like 1 (S. cerevisiae); MGC34245; R51H2; RAD51B; REC2; hREC2) (FITC); RAD51-like 1 (S. cerevisiae); hREC2; anti-RAD51L1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RAD51L1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
• Sequence Length: 384

• Applicable Applications for anti-RAD51L1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: RAD51L1 (NP_598193.2, 1aa-384aa) full-length human protein.
• Immunogen Sequence: MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

Western Blot (WB)

(Western Blot analysis of RAD51L1 expression in transfected 293T cell line by RAD51L1 MaxPab polyclonal antibody.Lane 1: RAD51L1 transfected lysate(42.20 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-RAD51L1 antibody

The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Product Categories/Family for anti-RAD51L1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 46255039
• NCBI GeneID: 5890
• NCBI Accession #: NP_598193.2
• NCBI GenBank Nucleotide #: NP_598193.2
• UniProt Accession #: O15315
• NCBI Official Full Name: DNA repair protein RAD51 homolog 2 isoform 3
• NCBI Official Synonym Full Names: RAD51 paralog B
• NCBI Official Symbol: RAD51B
• NCBI Official Synonym Symbols: REC2; R51H2; RAD51L1
• NCBI Protein Information: DNA repair protein RAD51 homolog 2
• UniProt Protein Name: DNA repair protein RAD51 homolog 2
• UniProt Gene Name: RAD51B
• UniProt Synonym Gene Names: RAD51L1; REC2; R51H2; Rad51B
• UniProt Entry Name: RA51B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. Rearrangements between this locus and high mobility group AT-hook 2 (HMGA2, GeneID 8091) have been observed in uterine leiomyomata. [provided by RefSeq, Mar 2016]

Uniprot Description

RAD51L1: Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. May promote the assembly of presynaptic RAD51 nucleoprotein filaments. The RAD51B- RAD51C dimer exhibits single-stranded DNA-dependent ATPase activity. The BCDX2 complex binds single-stranded DNA, single- stranded gaps in duplex DNA and specifically to nicks in duplex DNA. A chromosomal aberration involving RAD51B is found in pulmonary chondroid hamartoma. Translocation t(6;14)(p21;q23- 24) with HMGA1. A chromosomal aberration involving RAD51B is found in uterine leiomyoma. Translocation t(12;14)(q15;q23-24) with HMGA2. Belongs to the RecA family. RAD51 subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 14q23-q24.2

Cellular Component: nucleoplasm; replication fork; nucleus

Molecular Function: DNA-dependent ATPase activity; protein binding; DNA binding; four-way junction DNA binding; double-stranded DNA binding; single-stranded DNA binding; ATP binding

Biological Process: meiotic recombination; blood coagulation; DNA repair; double-strand break repair via homologous recombination; DNA recombination

Disease: Leiomyoma, Uterine