Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RAD51D AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Stomach)

Rabbit RAD51D Polyclonal Antibody | anti-RAD51D antibody

RAD51D Antibody - C-terminal region

Gene Names
RAD51D; TRAD; R51H3; BROVCA4; RAD51L3
Reactivity
Dog, Human, Mouse, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAD51D; Polyclonal Antibody; RAD51D Antibody - C-terminal region; anti-RAD51D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Mouse, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEM
Sequence Length
328
Applicable Applications for anti-RAD51D antibody
Western Blot (WB)
Homology
Dog: 79%; Human: 100%; Mouse: 79%; Pig: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAD51D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RAD51D AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Stomach)

Western Blot (WB) (WB Suggested Anti-RAD51D AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Stomach)
Related Product Information for anti-RAD51D antibody
This is a rabbit polyclonal antibody against RAD51D. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, which are known to be involved in the homologous recombination and repair of DNA. This protein forms a complex with several other members of the RAD51 family, including RAD51L1, RAD51L2, and XRCC2. The protein complex formed with this protein has been shown to catalyze homologous pairing between single- and double-stranded DNA, and is thought to play a role in the early stage of recombinational repair of DNA. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream ring finger and FYVE-like domain containing 1 (RFFL) gene.
Product Categories/Family for anti-RAD51D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
DNA repair protein RAD51 homolog 4 isoform 1
NCBI Official Synonym Full Names
RAD51 paralog D
NCBI Official Symbol
RAD51D
NCBI Official Synonym Symbols
TRAD; R51H3; BROVCA4; RAD51L3
NCBI Protein Information
DNA repair protein RAD51 homolog 4
UniProt Protein Name
DNA repair protein RAD51 homolog 4
Protein Family
UniProt Gene Name
RAD51D
UniProt Synonym Gene Names
RAD51L3
UniProt Entry Name
RA51D_HUMAN

NCBI Description

The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, which are known to be involved in the homologous recombination and repair of DNA. This protein forms a complex with several other members of the RAD51 family, including RAD51L1, RAD51L2, and XRCC2. The protein complex formed with this protein has been shown to catalyze homologous pairing between single- and double-stranded DNA, and is thought to play a role in the early stage of recombinational repair of DNA. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream ring finger and FYVE-like domain containing 1 (RFFL) gene. [provided by RefSeq, Jan 2011]

Uniprot Description

RAD51L3: Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. Defects in RAD51D are a cause of susceptibility to familial breast-ovarian cancer type 4 (BROVCA4). A condition associated with familial predisposition to cancer of the breast and ovaries. Characteristic features in affected families are an early age of onset of breast cancer (often before age 50), increased chance of bilateral cancers (cancer that develop in both breasts, or both ovaries, independently), frequent occurrence of breast cancer among men, increased incidence of tumors of other specific organs, such as the prostate. Belongs to the RecA family. RAD51 subfamily. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 17q11

Cellular Component: centrosome; chromosome, telomeric region; cytoplasm; replication fork; nucleus

Molecular Function: DNA-dependent ATPase activity; protein binding; gamma-tubulin binding; DNA binding; four-way junction DNA binding; single-stranded DNA binding; ATP binding

Biological Process: meiotic recombination; strand invasion; DNA repair; telomere maintenance; double-strand break repair via homologous recombination

Disease: Breast-ovarian Cancer, Familial, Susceptibility To, 4

Research Articles on RAD51D

Similar Products

Product Notes

The RAD51D rad51d (Catalog #AAA3215265) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAD51D Antibody - C-terminal region reacts with Dog, Human, Mouse, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's RAD51D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAD51D rad51d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLKPALGRSW SFVPSTRILL DTIEGAGASG GRRMACLAKS SRQPTGFQEM. It is sometimes possible for the material contained within the vial of "RAD51D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.