Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human RAD51B Polyclonal Antibody | anti-RAD51B antibody

RAD51B Polyclonal Antibody

Gene Names
RAD51B; REC2; R51H2; RAD51L1
Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
RAD51B; Polyclonal Antibody; RAD51B Polyclonal Antibody; R51H2; RAD51L1; REC2; anti-RAD51B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
ATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHH
Sequence Length
231
Applicable Applications for anti-RAD51B antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50 - 1:100
Immunogen
Recombinant protein of human RAD51B
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-RAD51B antibody
The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. Rearrangements between this locus and high mobility group AT-hook 2 (HMGA2, GeneID 8091) have been observed in uterine leiomyomata.
Product Categories/Family for anti-RAD51B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25kDa/38kDa/40kDa/42kDa
NCBI Official Full Name
DNA repair protein RAD51 homolog 2 isoform 10
NCBI Official Synonym Full Names
RAD51 paralog B
NCBI Official Symbol
RAD51B
NCBI Official Synonym Symbols
REC2; R51H2; RAD51L1
NCBI Protein Information
DNA repair protein RAD51 homolog 2
UniProt Protein Name
DNA repair protein RAD51 homolog 2
Protein Family
UniProt Gene Name
RAD51B
UniProt Synonym Gene Names
RAD51L1; REC2; R51H2; Rad51B

NCBI Description

The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. Rearrangements between this locus and high mobility group AT-hook 2 (HMGA2, GeneID 8091) have been observed in uterine leiomyomata. [provided by RefSeq, Mar 2016]

Uniprot Description

Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. May promote the assembly of presynaptic RAD51 nucleoprotein filaments. Binds single-stranded DNA and double-stranded DNA and has DNA-dependent ATPase activity. Part of the RAD21 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. The BCDX2 subcomplex RAD51B:RAD51C exhibits single-stranded DNA-dependent ATPase activity suggesting an involvement in early stages of the HR pathway.

Research Articles on RAD51B

Similar Products

Product Notes

The RAD51B rad51b (Catalog #AAA9134066) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAD51B Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAD51B can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50 - 1:100. Researchers should empirically determine the suitability of the RAD51B rad51b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ATLPTNMGGL EGAVVYIDTE SAFSAERLVE IAESRFPRYF NTEEKLLLTS SKVHLYRELT CDEVLQRIES LEEEIISKGI KLVILDSVAS VVRKEFDAQL QGNLKERNKF LAREASSLKY LAEEFSIPVI LTNQITTHLS GALASQADLV SPADDLSLSE GTSGSSCVIA ALGNTWSHSV NTRLILQYLD SERRQILIAK SPLAPFTSFV YTIKEEGLVL QETTFCSVTQ AELNWAPEIL PPQPPEQLGL QMCHH. It is sometimes possible for the material contained within the vial of "RAD51B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.