Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RAD17Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human RAD17 Polyclonal Antibody | anti-RAD17 antibody

RAD17 Antibody-C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAD17; Polyclonal Antibody; RAD17 Antibody-C-terminal region; cell cycle checkpoint protein RAD17; CCYC; R24L; RAD24; HRAD17; RAD17SP; anti-RAD17 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
LTDREHGMIDPDSGDEAQLNGGHSAEESLGEPTQATVPETWSLPLSQNSA
Applicable Applications for anti-RAD17 antibody
Western Blot (WB)
Protein Size
681 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RAD17
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RAD17Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RAD17Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RAD17 antibody
Description of Target: The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by the checkpoint kinase ATR following damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation. The phosphorylation of this protein is required for the DNA-damage-induced cell cycle G2 arrest, and is thought to be a critical early event during checkpoint signaling in DNA-damaged cells. Multiple alternatively spliced transcript variants of this gene, which encode four distinct protein isoforms, have been reported. Two pseudogenes, located on chromosomes 7 and 13, have been identified.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
77kDa
UniProt Protein Name
Cell cycle checkpoint protein RAD17
Protein Family
UniProt Gene Name
RAD17
UniProt Synonym Gene Names
R24L; hRad17
UniProt Entry Name
RAD17_HUMAN

Uniprot Description

RAD17: a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. Shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. Binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. Phosphorylated and activated after DNA damage, inducing cell cycle G2 arrest. Eight alternatively spliced variants have been reported.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 5q13

Cellular Component: nucleoplasm; chromosome, telomeric region; nucleus

Molecular Function: protein binding; ATP binding

Biological Process: regulation of phosphorylation; negative regulation of DNA replication; mitotic cell cycle checkpoint; DNA damage checkpoint; DNA replication; DNA repair; DNA replication checkpoint; response to DNA damage stimulus

Similar Products

Product Notes

The RAD17 rad17 (Catalog #AAA3249908) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAD17 Antibody-C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAD17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAD17 rad17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LTDREHGMID PDSGDEAQLN GGHSAEESLG EPTQATVPET WSLPLSQNSA. It is sometimes possible for the material contained within the vial of "RAD17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.