Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human RABL2B Polyclonal Antibody | anti-RABL2B antibody

RABL2B (Rab-like Protein 2B, FLJ93981, FLJ98216)

Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
RABL2B; Polyclonal Antibody; RABL2B (Rab-like Protein 2B; FLJ93981; FLJ98216); Anti -RABL2B (Rab-like Protein 2B; anti-RABL2B antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RABL2B.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS
Applicable Applications for anti-RABL2B antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Western Blot and Immunoprecipitation.
Immunogen
Full length human RABL2B, aa1-229 (NP_001003789.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RABL2B expression in transfected 293T cell line by RABL2B polyclonal antibody. Lane 1: RABL2B transfected lysate (26.2kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of RABL2B transfected lysate using RABL2B rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with RABL2B mouse polyclonal antibody.)

Product Categories/Family for anti-RABL2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,101 Da
NCBI Official Full Name
rab-like protein 2B isoform 3
NCBI Official Synonym Full Names
RAB, member of RAS oncogene family-like 2B
NCBI Official Symbol
RABL2B
NCBI Protein Information
rab-like protein 2B
UniProt Protein Name
Rab-like protein 2B
Protein Family
UniProt Gene Name
RABL2B
UniProt Entry Name
RBL2B_HUMAN

NCBI Description

The RABL2B protein is a member of the RAB gene family which belongs to the RAS GTPase superfamily. RABL2B is located within a subtelomeric region of 22q13.3. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

Uniprot Description

Sequence similarities: Belongs to the small GTPase superfamily. Rab family.

Research Articles on RABL2B

Similar Products

Product Notes

The RABL2B rabl2b (Catalog #AAA647491) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RABL2B (Rab-like Protein 2B, FLJ93981, FLJ98216) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RABL2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the RABL2B rabl2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAEDKTKPSE LDQGKYDADD NVKIICLGDS AVGKSKLMER FLMDGFQPQQ LSTYALTLYK HTATVDGRTI LVDFWDTAGQ ERFQSMHASY YHKAHACIMV FDVQRKVTYR NLSTWYTELR EFRPEIPCIV VANKIDADIN VTQKSFNFAK KFSLPLYFVS AADGTNVVKL FNDAIRLAVS YKQNSQDFMD EIFQELENFS LEQEEEDVPD QEQSSSIETP SEEAASPHS. It is sometimes possible for the material contained within the vial of "RABL2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual