Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: Human, MouseSample Type: 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with mouse Rab8B-GFP  (15ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution: 1:40,000Image Submitted by:  Dr. Jakob Szwedo, Dr. Lupashin's LabUniversity of Arkansas for Medical SciencesSee Customer Feedback tab for detailed information.)

Rabbit RAB8B Polyclonal Antibody | anti-RAB8B antibody

RAB8B antibody - C-terminal region

Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAB8B; Polyclonal Antibody; RAB8B antibody - C-terminal region; anti-RAB8B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAK
Sequence Length
207
Applicable Applications for anti-RAB8B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RAB8B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: Human, MouseSample Type: 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with mouse Rab8B-GFP  (15ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution: 1:40,000Image Submitted by:  Dr. Jakob Szwedo, Dr. Lupashin's LabUniversity of Arkansas for Medical SciencesSee Customer Feedback tab for detailed information.)

Western Blot (WB) (Sample Type: Human, MouseSample Type: 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with mouse Rab8B-GFP  (15ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution: 1:40,000Image Submitted by:  Dr. Jakob Szwedo, Dr. Lupashin's LabUniversity of Arkansas for Medical SciencesSee Customer Feedback tab for detailed information.)

Western Blot (WB)

(WB Suggested Anti-RAB8B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)

Western Blot (WB) (WB Suggested Anti-RAB8B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)
Related Product Information for anti-RAB8B antibody
This is a rabbit polyclonal antibody against RAB8B. It was validated on Western Blot

Target Description: RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).
Product Categories/Family for anti-RAB8B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
ras-related protein Rab-8B
NCBI Official Synonym Full Names
RAB8B, member RAS oncogene family
NCBI Official Symbol
RAB8B
NCBI Protein Information
ras-related protein Rab-8B
UniProt Protein Name
Ras-related protein Rab-8B
Protein Family
UniProt Gene Name
RAB8B
UniProt Entry Name
RAB8B_HUMAN

NCBI Description

RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).[supplied by OMIM, Nov 2010]

Uniprot Description

RAB8B: May be involved in vesicular trafficking and neurotransmitter release. May participate in cell junction dynamics in Sertoli cells. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein; Motility/polarity/chemotaxis; G protein, monomeric; G protein, monomeric, Rab

Chromosomal Location of Human Ortholog: 15q22.2

Cellular Component: peroxisomal membrane; phagocytic vesicle membrane; trans-Golgi network transport vesicle; synaptic vesicle; mitochondrion; perinuclear region of cytoplasm; secretory granule membrane; plasma membrane; phagocytic vesicle; endosome

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; TPR domain binding; receptor binding

Biological Process: regulation of exocytosis; antigen processing and presentation; synaptic vesicle exocytosis; Golgi vesicle fusion to target membrane; cellular response to insulin stimulus; metabolic process; positive regulation of cell projection organization and biogenesis; protein secretion; cilium biogenesis; protein import into peroxisome membrane; Rab protein signal transduction; vesicle docking during exocytosis; positive regulation of adrenocorticotropic hormone secretion

Research Articles on RAB8B

Similar Products

Product Notes

The RAB8B rab8b (Catalog #AAA3214442) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB8B antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RAB8B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB8B rab8b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RNIEEHASSD VERMILGNKC DMNDKRQVSK ERGEKLAIDY GIKFLETSAK. It is sometimes possible for the material contained within the vial of "RAB8B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.