Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RAB3GAP2Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit RAB3GAP2 Polyclonal Antibody | anti-RAB3GAP2 antibody

RAB3GAP2 Antibody - middle region

Gene Names
RAB3GAP2; p150; SPG69; WARBM2; RAB3GAP150; RAB3-GAP150
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAB3GAP2; Polyclonal Antibody; RAB3GAP2 Antibody - middle region; anti-RAB3GAP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSG
Sequence Length
206
Applicable Applications for anti-RAB3GAP2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human RAB3GAP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RAB3GAP2Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RAB3GAP2Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RAB3GAP2 antibody
This is a rabbit polyclonal antibody against RAB3GAP2. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the RAB3 protein family, members of which are involved in regulated exocytosis of neurotransmitters and hormones. This protein forms the Rab3 GTPase-activating complex with RAB3GAP1, where it constitutes the regulatory subunit, whereas the latter functions as the catalytic subunit. This gene has the highest level of expression in the brain, consistent with it having a key role in neurodevelopment. Mutations in this gene are associated with Martsolf syndrome.
Product Categories/Family for anti-RAB3GAP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
rab3 GTPase-activating protein non-catalytic subunit
NCBI Official Synonym Full Names
RAB3 GTPase activating non-catalytic protein subunit 2
NCBI Official Symbol
RAB3GAP2
NCBI Official Synonym Symbols
p150; SPG69; WARBM2; RAB3GAP150; RAB3-GAP150
NCBI Protein Information
rab3 GTPase-activating protein non-catalytic subunit
UniProt Protein Name
Rab3 GTPase-activating protein non-catalytic subunit
UniProt Gene Name
RAB3GAP2
UniProt Synonym Gene Names
KIAA0839; Rab3-GAP150
UniProt Entry Name
RBGPR_HUMAN

NCBI Description

The protein encoded by this gene belongs to the RAB3 protein family, members of which are involved in regulated exocytosis of neurotransmitters and hormones. This protein forms the Rab3 GTPase-activating complex with RAB3GAP1, where it constitutes the regulatory subunit, whereas the latter functions as the catalytic subunit. This gene has the highest level of expression in the brain, consistent with it having a key role in neurodevelopment. Mutations in this gene are associated with Martsolf syndrome.[provided by RefSeq, Oct 2009]

Uniprot Description

RAB3GAP2: Regulatory subunit of a GTPase activating protein that has specificity for Rab3 subfamily (RAB3A, RAB3B, RAB3C and RAB3D). Rab3 proteins are involved in regulated exocytosis of neurotransmitters and hormones. Rab3 GTPase-activating complex specifically converts active Rab3-GTP to the inactive form Rab3- GDP. Required for normal eye and brain development. May participate in neurodevelopmental processes such as proliferation, migration and differentiation before synapse formation, and non- synaptic vesicular release of neurotransmitters. Defects in RAB3GAP2 are the cause of Martsolf syndrome (MARTS). Martsolf syndrome is characterized by congenital cataracts, mental retardation, and hypogonadism. Inheritance is autosomal recessive. Defects in RAB3GAP2 are the cause of Warburg micro syndrome type 2 (WARBM2). WARBM2 is a rare syndrome characterized by microcephaly, microphthalmia, microcornia, congenital cataracts, optic atrophy, cortical dysplasia, in particular corpus callosum hypoplasia, severe mental retardation, spastic diplegia, and hypogonadism. Belongs to the Rab3-GAP regulatory subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs, Rab; GAPs

Chromosomal Location of Human Ortholog: 1q41

Cellular Component: protein complex; cytoplasm; plasma membrane

Molecular Function: protein heterodimerization activity; enzyme activator activity; Rab guanyl-nucleotide exchange factor activity; Rab GTPase binding; enzyme regulator activity; GTPase activator activity

Biological Process: positive regulation of catalytic activity; intracellular protein transport; regulation of GTPase activity; positive regulation of GTPase activity

Disease: Martsolf Syndrome; Warburg Micro Syndrome 2

Research Articles on RAB3GAP2

Similar Products

Product Notes

The RAB3GAP2 rab3gap2 (Catalog #AAA3217615) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB3GAP2 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RAB3GAP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB3GAP2 rab3gap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SWLQDCVLSL SPTNDLMVIA REQKAVFLVP KWKYSDKGKE EMQFAVGWSG. It is sometimes possible for the material contained within the vial of "RAB3GAP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.