Western Blot (WB)
(Host: RabbitTarget Name: RAB3GAP1Sample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human RAB3GAP1 Polyclonal Antibody | anti-RAB3GAP1 antibody
RAB3GAP1 Antibody - middle region
Gene Names
RAB3GAP1; P130; WARBM1; RAB3GAP; RAB3GAP130
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RAB3GAP1; Polyclonal Antibody; RAB3GAP1 Antibody - middle region; anti-RAB3GAP1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 29% sucrose.
Sequence
Synthetic peptide located within the following region: VLQDWQQYFWPQQPPDIDALVGGEVGGLEFGKLPFGACEDPISELHLATT
Sequence Length
881
Applicable Applications for anti-RAB3GAP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RAB3GAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RAB3GAP1Sample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RAB3GAP1Sample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RAB3GAP1 antibody
This gene encodes the catalytic subunit of a Rab GTPase activating protein. The encoded protein forms a heterodimer with a non-catalytic subunit to specifically regulate the activity of members of the Rab3 subfamily of small G proteins. This protein mediates the hydrolysis of GTP bound Rab3 to the GDP bound form. Mutations in this gene are associated with Warburg micro syndrome. Alternate splicing results in multiple transcript variants.
Product Categories/Family for anti-RAB3GAP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
96 kDa
NCBI Official Full Name
rab3 GTPase-activating protein catalytic subunit isoform 1
NCBI Official Synonym Full Names
RAB3 GTPase activating protein catalytic subunit 1
NCBI Official Symbol
RAB3GAP1
NCBI Official Synonym Symbols
P130; WARBM1; RAB3GAP; RAB3GAP130
NCBI Protein Information
rab3 GTPase-activating protein catalytic subunit
Protein Family
NCBI Description
This gene encodes the catalytic subunit of a Rab GTPase activating protein. The encoded protein forms a heterodimer with a non-catalytic subunit to specifically regulate the activity of members of the Rab3 subfamily of small G proteins. This protein mediates the hydrolysis of GTP bound Rab3 to the GDP bound form. Mutations in this gene are associated with Warburg micro syndrome. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2010]
Research Articles on RAB3GAP1
Similar Products
Product Notes
The RAB3GAP1 (Catalog #AAA3221051) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB3GAP1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB3GAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB3GAP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLQDWQQYFW PQQPPDIDAL VGGEVGGLEF GKLPFGACED PISELHLATT. It is sometimes possible for the material contained within the vial of "RAB3GAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
