Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RAB27B expression in human spleen using MBS6011696.)

Rabbit anti-Human RAB27B Polyclonal Antibody | anti-RAB27B antibody

RAB27B (Ras-related Protein Rab-27B, C25KG)

Gene Names
RAB27B; C25KG
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RAB27B; Polyclonal Antibody; RAB27B (Ras-related Protein Rab-27B; C25KG); Anti -RAB27B (Ras-related Protein Rab-27B; anti-RAB27B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RAB27B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRSWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
Applicable Applications for anti-RAB27B antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human RAB27B, aa1-218 (AAH27474.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RAB27B expression in human spleen using MBS6011696.)

Western Blot (WB) (Western Blot analysis of RAB27B expression in human spleen using MBS6011696.)

Western Blot (WB)

(Western Blot analysis of RAB27B expression in HeLa using MBS6011696.)

Western Blot (WB) (Western Blot analysis of RAB27B expression in HeLa using MBS6011696.)

Western Blot (WB)

(Western Blot analysis of RAB27B expression in transfected 293T cell line by MBS6011696. Lane 1: RAB27B transfected lysate (24.09kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RAB27B expression in transfected 293T cell line by MBS6011696. Lane 1: RAB27B transfected lysate (24.09kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RAB27B antibody
RAB27B may be involved in targeting uroplakins to urothelial apical membranes.
Product Categories/Family for anti-RAB27B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
24,608 Da
NCBI Official Full Name
RAS-related protein RAB27B
NCBI Official Synonym Full Names
RAB27B, member RAS oncogene family
NCBI Official Symbol
RAB27B
NCBI Official Synonym Symbols
C25KG
NCBI Protein Information
ras-related protein Rab-27B
UniProt Protein Name
Ras-related protein Rab-27B
Protein Family
UniProt Gene Name
RAB27B
UniProt Entry Name
RB27B_HUMAN

NCBI Description

Members of the Rab protein family, including RAB27B, are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking (Chen et al., 1997 [PubMed 9066979]).[supplied by OMIM, Nov 2010]

Uniprot Description

RAB27B: May be involved in targeting uroplakins to urothelial apical membranes. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein, monomeric, Rab; G protein, monomeric

Chromosomal Location of Human Ortholog: 18q21.2

Cellular Component: trans-Golgi network transport vesicle; Golgi stack; zymogen granule membrane; apical plasma membrane; melanosome; secretory granule

Molecular Function: GTPase activity; protein domain specific binding; protein binding; GDP binding; GTP binding; myosin V binding

Biological Process: intracellular protein transport; metabolic process; protein secretion; Rab protein signal transduction; melanosome transport; vesicle docking during exocytosis; positive regulation of exocytosis

Research Articles on RAB27B

Similar Products

Product Notes

The RAB27B rab27b (Catalog #AAA6011696) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB27B (Ras-related Protein Rab-27B, C25KG) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB27B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the RAB27B rab27b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTDGDYDYLI KLLALGDSGV GKTTFLYRYT DNKFNPKFIT TVGIDFREKR VVYNAQGPNG SSGKAFKVHL QLWDTAGQER FRSLTTAFFR DAMGFLLMFD LTSQQSFLNV RSWMSQLQAN AYCENPDIVL IGNKADLPDQ REVNERQARE LADKYGIPYF ETSAATGQNV EKAVETLLDL IMKRMEQCVE KTQIPDTVNG GNSGNLDGEK PPEKKCIC. It is sometimes possible for the material contained within the vial of "RAB27B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.