Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of RAB22A transfected lysate using RAB22A rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with RAB22A mouse polyclonal antibody.)

Rabbit anti-Human RAB22A Polyclonal Antibody | anti-RAB22A antibody

RAB22A (Ras-related Protein Rab-22A, RAB22, Rab-22)

Reactivity
Human
Applications
Immunoprecipitation
Purity
Serum
Serum
Synonyms
RAB22A; Polyclonal Antibody; RAB22A (Ras-related Protein Rab-22A; RAB22; Rab-22); Anti -RAB22A (Ras-related Protein Rab-22A; anti-RAB22A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RAB22A.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MALRELRVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRRHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC
Applicable Applications for anti-RAB22A antibody
Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation.
Immunogen
Full length human RAB22A, aa1-195 (AAH15710.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of RAB22A transfected lysate using RAB22A rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with RAB22A mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of RAB22A transfected lysate using RAB22A rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with RAB22A mouse polyclonal antibody.)
Product Categories/Family for anti-RAB22A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
21,855 Da
NCBI Official Full Name
RAB22A, member RAS oncogene family, isoform CRA_a
NCBI Official Synonym Full Names
RAB22A, member RAS oncogene family
NCBI Official Symbol
RAB22A
NCBI Protein Information
ras-related protein Rab-22A; rab-22; GTP-binding protein RAB22A
UniProt Protein Name
Ras-related protein Rab-22A
Protein Family
UniProt Gene Name
RAB22A
UniProt Synonym Gene Names
RAB22; Rab-22
UniProt Entry Name
RB22A_HUMAN

NCBI Description

The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments. [provided by RefSeq, Jul 2008]

Uniprot Description

RAB22A: is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments. [provided by RefSeq, Jul 2008]

Protein type: G protein, monomeric; G protein; G protein, monomeric, Rab

Chromosomal Location of Human Ortholog: 20q13.32

Cellular Component: ruffle; phagocytic vesicle membrane; early endosome; plasma membrane; endosome membrane; phagocytic vesicle; actin cytoskeleton

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding

Biological Process: intracellular protein transport; endosome organization and biogenesis; metabolic process; endocytosis; Rab protein signal transduction

Research Articles on RAB22A

Similar Products

Product Notes

The RAB22A rab22a (Catalog #AAA6005284) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB22A (Ras-related Protein Rab-22A, RAB22, Rab-22) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB22A can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Suitable for use in Immunoprecipitation. Researchers should empirically determine the suitability of the RAB22A rab22a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MALRELRVCL LGDTGVGKSS IVWRFVEDSF DPNINPTIGA SFMTKTVQYQ NELHKFLIWD TAGQERFRAL APMYYRGSAA AIIVYDITKE ETFSTLKNWV KELRRHGPPN IVVAIAGNKC DLIDVREVME RDAKDYADSI HAIFVETSAK NAININELFI EISRRIPSTD ANLPSGGKGF KLRRQPSEPK RSCC. It is sometimes possible for the material contained within the vial of "RAB22A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.