Western Blot (WB)
(Host: RabbitTarget Name: Qsox2Sample Type: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)
Rabbit Qsox2 Polyclonal Antibody | anti-QSOX2 antibody
Qsox2 Antibody - C-terminal region
Gene Names
Qsox2; Soxn; Qscn6l1; BC030934
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Qsox2; Polyclonal Antibody; Qsox2 Antibody - C-terminal region; anti-QSOX2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SWNEGQVLLFLKQHYSRDNLVDAYSVDQGSPGSVLRARPWLGQMARLSHV
Sequence Length
692
Applicable Applications for anti-QSOX2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 85%; Guinea Pig: 79%; Human: 100%; Mouse: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Qsox2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Qsox2Sample Type: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Qsox2Sample Type: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-QSOX2 antibody
This is a rabbit polyclonal antibody against Qsox2. It was validated on Western Blot
Target Description: Qsox2 catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide. It may contribute to disulfide bond formation in a variety of secreted proteins.
Target Description: Qsox2 catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide. It may contribute to disulfide bond formation in a variety of secreted proteins.
Product Categories/Family for anti-QSOX2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
sulfhydryl oxidase 2 isoform 2
NCBI Official Synonym Full Names
quiescin Q6 sulfhydryl oxidase 2
NCBI Official Symbol
Qsox2
NCBI Official Synonym Symbols
Soxn; Qscn6l1; BC030934
NCBI Protein Information
sulfhydryl oxidase 2
UniProt Protein Name
Sulfhydryl oxidase 2
Protein Family
UniProt Gene Name
Qsox2
UniProt Synonym Gene Names
Qscn6l1
UniProt Entry Name
QSOX2_MOUSE
NCBI Description
This gene encodes a member of the sulfhydryl oxidase protein family. Members of this family catalyze formation of disulfide bonds. A similar protein in humans may sensitize neuroblastoma cells to interferon gamma-induced cell death. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]
Similar Products
Product Notes
The QSOX2 qsox2 (Catalog #AAA3217408) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Qsox2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Qsox2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the QSOX2 qsox2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SWNEGQVLLF LKQHYSRDNL VDAYSVDQGS PGSVLRARPW LGQMARLSHV. It is sometimes possible for the material contained within the vial of "Qsox2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
