Mouse GAPDH Monoclonal Antibody | anti-GAPDH antibody

GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase, G3PD, GAPD, MGC88685) (AP)

• Gene Names: GAPDH; G3PD; GAPD; HEL-S-162eP
• Applications: Western Blot
• Purity: Purified
• Synonyms: GAPDH; Monoclonal Antibody; GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase; G3PD; GAPD; MGC88685) (AP); Glyceraldehyde-3-Phosphate Dehydrogenase; MGC88685; anti-GAPDH antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3C2
• Specificity: Recognizes GAPDH.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-GAPDH antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: GAPDH (NP_002037, 226aa-335aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of GAPDH expression in transfected 293T cell line by GAPDH monoclonal antibody (M01), clone 3C2.Lane 1: GAPDH transfected lysate(36.1 KDa).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in Raw 264.7.)

WB (Western Blot)

(GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in PC-12.)

WB (Western Blot)

(GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in NIH/3T3.)

WB (Western Blot)

(GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in HeLa.)

WB (Western Blot)

(GAPDH monoclonal antibody (M01), clone 3C2 Western Blot analysis of GAPDH expression in A-431.)

Related Product Information for anti-GAPDH antibody

The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. [provided by RefSeq]

Product Categories/Family for anti-GAPDH antibody

Antibodies; Enzymes; Dehydrogenase

References

1. Reticulon 3 interacts with NS4B of the hepatitis C virus and negatively regulates viral replication by disrupting NS4B self-interaction.Wu MJ, Ke PY, Hsu JT, Yeh CT, Horng JTCell Microbiol. 2014 Jun 4. doi: 10.1111/cmi.12318. 2.Receptor for Activated Protein Kinase C: Requirement for Efficient MicroRNA Function and Reduced Expression in Hepatocellular Carcinoma. Otsuka M, Takata A, Yoshikawa T, Kojima K, Kishikawa T, Shibata C, Takekawa M, Yoshida H, Omata M, Koike K.PLoS One. 2011;6(9):e24359. Epub 2011 Sep 15. 3.Expression and roles of Slit/Robo in human ovarian cancer. Dai CF, Jiang YZ, Li Y, Wang K, Liu PS, Patankar MS, Zheng J.Histochem Cell Biol. 2011 Apr 5. 4. Anti-angiogenic effect of triterpenoidal saponins from Polygala senega. Arai M, Hayashi A, Sobou M, Ishida S, Kawachi T, Kotoku N, Kobayashi M.J Nat Med. 2010 Nov 2. 5. The Effect of Allelic Variation in Aldo-Keto Reductase 1C2 on the In Vitro Metabolism of Dihydrotestosterone. Takahashi RH, Grigliatti TA, Reid RE, Riggs KW.J Pharmacol Exp Ther. 2009 Jun;329(3):1032-9. Epub 2009 Mar 3.

NCBI and Uniprot Product Information

• NCBI GI #: 7669492
• NCBI GeneID: 2597
• NCBI Accession #: NP_002037
• NCBI GenBank Nucleotide #: NM_002046.5
• UniProt Accession #: P04406; P00354; Q53X65; E7EUT4
• Molecular Weight: Predicted: 37 kDa; ; Observed: 36 kDa
• NCBI Official Full Name: glyceraldehyde-3-phosphate dehydrogenase isoform 1
• NCBI Official Synonym Full Names: glyceraldehyde-3-phosphate dehydrogenase
• NCBI Official Symbol: GAPDH
• NCBI Official Synonym Symbols: G3PD; GAPD; HEL-S-162eP
• NCBI Protein Information: glyceraldehyde-3-phosphate dehydrogenase; aging-associated gene 9 protein; peptidyl-cysteine S-nitrosylase GAPDH; epididymis secretory sperm binding protein Li 162eP
• UniProt Protein Name: Glyceraldehyde-3-phosphate dehydrogenase
• UniProt Gene Name: GAPDH
• UniProt Synonym Gene Names: GAPD; GAPDH
• UniProt Entry Name: G3P_HUMAN