Western Blot (WB)
(PYCR1 antibody - middle region validated by WB using 293T cells lysate at 1 ug/ml.PYCR1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Rabbit PYCR1 Polyclonal Antibody | anti-PYCR1 antibody
PYCR1 antibody - middle region
Gene Names
PYCR1; P5C; P5CR; PRO3; PYCR; PIG45; PP222; ARCL2B; ARCL3B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PYCR1; Polyclonal Antibody; PYCR1 antibody - middle region; anti-PYCR1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR
Sequence Length
316
Applicable Applications for anti-PYCR1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PYCR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(PYCR1 antibody - middle region validated by WB using 293T cells lysate at 1 ug/ml.PYCR1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Western Blot (WB)
(PYCR1 antibody - middle region validated by WB using 293T cells lysate at 1 ug/ml.PYCR1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Western Blot (WB)
(WB Suggested Anti-PYCR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysatePYCR1 is supported by BioGPS gene expression data to be expressed in HepG2)
Western Blot (WB)
(WB Suggested Anti-PYCR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysatePYCR1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-PYCR1 antibody
This is a rabbit polyclonal antibody against PYCR1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes
Target Description: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes
Product Categories/Family for anti-PYCR1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33kDa
NCBI Official Full Name
pyrroline-5-carboxylate reductase 1, mitochondrial isoform 2
NCBI Official Synonym Full Names
pyrroline-5-carboxylate reductase 1
NCBI Official Symbol
PYCR1
NCBI Official Synonym Symbols
P5C; P5CR; PRO3; PYCR; PIG45; PP222; ARCL2B; ARCL3B
NCBI Protein Information
pyrroline-5-carboxylate reductase 1, mitochondrial
Protein Family
NCBI Description
This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes to the mitochondrion. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Research Articles on PYCR1
Similar Products
Product Notes
The PYCR1 (Catalog #AAA3213534) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PYCR1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PYCR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PYCR1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KMLLHSEQHP GQLKDNVSSP GGATIHALHV LESGGFRSLL INAVEASCIR. It is sometimes possible for the material contained within the vial of "PYCR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
