Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PYCARD Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Human Thymus)

Rabbit anti-Mouse, Rat PYCARD Polyclonal Antibody | anti-PYCARD antibody

PYCARD antibody - middle region

Gene Names
Pycard; Asc; TNS1; masc; CARD5; TMS-1; 9130417A21Rik
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
PYCARD; Polyclonal Antibody; PYCARD antibody - middle region; anti-PYCARD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TVLRDMGLQELAEQLQTTKEESGAVAAAASVPAQSTARTGHFVDQHRQAL
Sequence Length
193
Applicable Applications for anti-PYCARD antibody
Western Blot (WB)
Homology
Mouse: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse PYCARD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PYCARD Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Human Thymus)

Western Blot (WB) (WB Suggested Anti-PYCARD Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Human Thymus)
Related Product Information for anti-PYCARD antibody
This is a rabbit polyclonal antibody against PYCARD. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Pycard is a cytosolic soluble protein that forms insoluble aggregates and enhances etoposide-induced apoptosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
apoptosis-associated speck-like protein containing a CARD
NCBI Official Synonym Full Names
PYD and CARD domain containing
NCBI Official Symbol
Pycard
NCBI Official Synonym Symbols
Asc; TNS1; masc; CARD5; TMS-1; 9130417A21Rik
NCBI Protein Information
apoptosis-associated speck-like protein containing a CARD
UniProt Protein Name
Apoptosis-associated speck-like protein containing a CARD
UniProt Gene Name
Pycard
UniProt Synonym Gene Names
Asc; mASC
UniProt Entry Name
ASC_MOUSE

Uniprot Description

PYCARD: Promotes caspase-mediated apoptosis. This proapoptotic activity is mediated predominantly through the activation of caspase-9. May be a component of the inflammasome, a protein complex which also includes NALP2, CARD8 and CASP1 and whose function would be the activation of proinflammatory caspases. Forms complexes with other DAPIN domain-containing proteins. Interacts with CIAS1/PYPAF1 and PYDC1. Widely expressed at low levels. Detected in peripheral blood leukocytes, lung, small intestine, spleen, thymus, colon and at lower levels in placenta, liver and kidney. Very low expression in skeletal muscle, heart and brain. Detected in the leukemia cell lines HL-60 and U-937, but not in Jurkat T- cell lymphoma and Daudi Burkitt's lymphoma. Detected in the melanoma cell line WM35, but not in WM793. Not detected in HeLa cervical carcinoma cells and MOLT-4 lymphocytic leukemia cells. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; Adaptor/scaffold

Cellular Component: protein complex; mitochondrion; cell soma; endoplasmic reticulum; cytoplasm; extracellular region; nucleolus; IkappaB kinase complex; cytosol; nucleus

Molecular Function: protein binding; protein homodimerization activity; protease binding; apoptotic protease activator activity; Pyrin domain binding

Biological Process: myeloid dendritic cell activation during immune response; apoptosis; positive regulation of apoptosis; regulation of protein stability; positive regulation of caspase activity; positive regulation of JNK cascade; positive regulation of interleukin-1 beta secretion; defense response to Gram-negative bacterium; regulation of caspase activity; positive regulation of activated T cell proliferation; activation of NF-kappaB transcription factor; regulation of apoptosis; tumor necrosis factor-mediated signaling pathway; positive regulation of phagocytosis; inflammatory response; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; defense response to virus; positive regulation of adaptive immune response; caspase activation; regulation of GTPase activity; immune system process; positive regulation of interleukin-6 production; interleukin-1 beta production; negative regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of tumor necrosis factor production; negative regulation of interferon-beta production; myeloid dendritic cell activation; positive regulation of interferon-gamma production; positive regulation of actin filament polymerization; response to bacterium; inhibition of NF-kappaB transcription factor; regulation of inflammatory response; innate immune response; positive regulation of transcription factor activity; regulation of autophagy; positive regulation of T cell activation; positive regulation of defense response to virus by host; activation of innate immune response; positive regulation of antigen processing and presentation of peptide antigen via MHC class II

Research Articles on PYCARD

Similar Products

Product Notes

The PYCARD pycard (Catalog #AAA3203539) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PYCARD antibody - middle region reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PYCARD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PYCARD pycard for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVLRDMGLQE LAEQLQTTKE ESGAVAAAAS VPAQSTARTG HFVDQHRQAL. It is sometimes possible for the material contained within the vial of "PYCARD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.