Rabbit PWP2 Polyclonal Antibody | anti-PWP2 antibody

PWP2 antibody - middle region

Cat. Num. AAA3207932

• Gene Names: PWP2; UTP1; PWP2H; EHOC-17
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: PWP2; Polyclonal Antibody; PWP2 antibody - middle region; anti-PWP2 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM
• Sequence Length: 919

• Applicable Applications for anti-PWP2 antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PWP2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PWP2Sample Type: 721_BAntibody Dilution: 1.0ug/mlPWP2 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB)

(Host: RabbitTarget Name: PWP2Sample Type: JurkatAntibody Dilution: 1.0ug/mlPWP2 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB)

(Host: RabbitTarget Name: PWP2Sample Type: MCF7Antibody Dilution: 1.0ug/mlPWP2 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB)

(WB Suggested Anti-PWP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Related Product Information for anti-PWP2 antibody

This is a rabbit polyclonal antibody against PWP2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PWP2 belongs to the WD repeat PWP2 family. It contains 14 WD repeats. The exact function of PWP2 is not known.

Product Categories/Family for anti-PWP2 antibody

Polyclonal; Down Syndrome; Various

NCBI and Uniprot Product Information

• NCBI GI #: 48762926
• NCBI GeneID: 5822
• NCBI Accession #: NP_005040
• NCBI GenBank Nucleotide #: NM_005049
• UniProt Accession #: Q15269
• Molecular Weight: 102kDa
• NCBI Official Full Name: periodic tryptophan protein 2 homolog
• NCBI Official Synonym Full Names: PWP2 small subunit processome component
• NCBI Official Symbol: PWP2
• NCBI Official Synonym Symbols: UTP1; PWP2H; EHOC-17
• NCBI Protein Information: periodic tryptophan protein 2 homolog
• UniProt Protein Name: Periodic tryptophan protein 2 homolog
• Protein Family: Periodic tryptophan protein
• UniProt Gene Name: PWP2
• UniProt Synonym Gene Names: PWP2H
• UniProt Entry Name: PWP2_HUMAN