Western Blot (WB)
(PUS7 antibody (MBS5301785) used at 1.25 ug/ml to detect target protein.)
Rabbit PUS7 Polyclonal Antibody | anti-PUS7 antibody
PUS7 antibody
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
PUS7; Polyclonal Antibody; PUS7 antibody; Polyclonal PUS7; Anti-PUS7; PUS 7; FLJ20485; KIAA1897; PUS-7; MGC17720; Pseudouridylate Synthase 7 Homolog; anti-PUS7 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PUS7 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
311
Applicable Applications for anti-PUS7 antibody
Western Blot (WB)
Application Notes
WB: 1.25 ug/ml
Biological Significance
PUS7 is involved in RNA binding, pseudouridine synthase activity and isomerase activity.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
PUS7 antibody was raised using a synthetic peptide corresponding to a region with amino acids FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(PUS7 antibody (MBS5301785) used at 1.25 ug/ml to detect target protein.)
Western Blot (WB)
(PUS7 antibody (MBS5301785) used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-PUS7 antibody
Rabbit polyclonal PUS7 antibody
Product Categories/Family for anti-PUS7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
75 kDa (MW of target protein)
NCBI Official Full Name
PUS7 protein, partial
NCBI Official Synonym Full Names
pseudouridylate synthase 7 (putative)
NCBI Official Symbol
PUS7
NCBI Protein Information
pseudouridylate synthase 7 homolog
UniProt Protein Name
Pseudouridylate synthase 7 homolog
Protein Family
UniProt Gene Name
PUS7
UniProt Synonym Gene Names
KIAA1897
UniProt Entry Name
PUS7_HUMAN
Uniprot Description
PUS7: Belongs to the pseudouridine synthase TruD family.
Protein type: Isomerase; EC 5.4.99.-
Chromosomal Location of Human Ortholog: 7q22.3
Molecular Function: enzyme binding; pseudouridine synthase activity
Biological Process: pseudouridine synthesis; tRNA processing
Research Articles on PUS7
Similar Products
Product Notes
The PUS7 pus7 (Catalog #AAA5301785) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PUS7 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PUS7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1.25 ug/ml. Researchers should empirically determine the suitability of the PUS7 pus7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PUS7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
