Rabbit anti-Human PTPN7 Polyclonal Antibody | anti-PTPN7 antibody

PTPN7 Antibody - middle region

Cat. Num. AAA3220387

• Gene Names: PTPN7; LPTP; HEPTP; PTPNI; BPTP-4; LC-PTP
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: PTPN7; Polyclonal Antibody; PTPN7 Antibody - middle region; anti-PTPN7 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGY
• Sequence Length: 167

• Applicable Applications for anti-PTPN7 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTPN7
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PTPN7Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-PTPN7 antibody

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This gene is preferentially expressed in a variety of hematopoietic cells, and is an early response gene in lymphokine stimulated cells. The non-catalytic N-terminus of this PTP can interact with MAP kinases and suppress the MAP kinase activities. This PTP was shown to be involved in the regulation of T cell antigen receptor (TCR) signaling, which was thought to function through dephosphorylating the molecules related to MAP kinase pathway. Multiple alternatively spliced transcript variants have been found for this gene.

Product Categories/Family for anti-PTPN7 antibody

Polyclonal

NCBI and Uniprot Product Information

• NCBI GI #: 315221140
• NCBI GeneID: 5778
• NCBI Accession #: NP_002823.3
• NCBI GenBank Nucleotide #: NM_002832.3
• UniProt Accession #: P35236
• Molecular Weight: 41 kDa
• NCBI Official Full Name: tyrosine-protein phosphatase non-receptor type 7 isoform 1
• NCBI Official Synonym Full Names: protein tyrosine phosphatase non-receptor type 7
• NCBI Official Symbol: PTPN7
• NCBI Official Synonym Symbols: LPTP; HEPTP; PTPNI; BPTP-4; LC-PTP
• NCBI Protein Information: tyrosine-protein phosphatase non-receptor type 7
• UniProt Protein Name: Tyrosine-protein phosphatase non-receptor type 7
• Protein Family: Tyrosine-protein phosphatase non-receptor
• UniProt Gene Name: PTPN7
• UniProt Synonym Gene Names: HEPTP
• UniProt Entry Name: PTN7_HUMAN

NCBI Description

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This gene is preferentially expressed in a variety of hematopoietic cells, and is an early response gene in lymphokine stimulated cells. The non-catalytic N-terminus of this PTP can interact with MAP kinases and suppress the MAP kinase activities. This PTP was shown to be involved in the regulation of T cell antigen receptor (TCR) signaling, which was thought to function through dephosphorylating the molecules related to MAP kinase pathway. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

HePTP: a non-receptor protein-tyrosine phosphatase. Preferentially expressed in a variety of hematopoietic cells, and is an early response gene in lymphokine stimulated cells. Its noncatalytic N-terminus can interact with MAP kinases and suppress the MAP kinase activities. Shown to be involved in the regulation of T cell antigen receptor (TCR) signaling, which was thought to function through dephosphorylating the molecules related to MAP kinase pathway. Three alternatively spliced transcript variants of this gene, which encode two distinct isoforms, are reported. May play a role in the regulation of lymphocyte development.

Protein type: Motility/polarity/chemotaxis; EC 3.1.3.48; Protein phosphatase, tyrosine (non-receptor)

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: internal side of plasma membrane; cytoskeleton; cytoplasm; cytosol

Molecular Function: protein binding; protein tyrosine phosphatase activity

Biological Process: protein amino acid dephosphorylation