Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot - FAP Polyclonal Antibody. Western blot analysis of extracts of mouse heart, using FAP antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Exposure time: 30s.)

Rabbit anti-Human, Mouse PTPN13/FAP-1 Polyclonal Antibody | anti-PTPN13/FAP-1 antibody

PTPN13/FAP-1 Rabbit pAb

Gene Names
FAP; FAPA; DPPIV
Reactivity
Human, Mouse
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Purity
Affinity purified
Synonyms
PTPN13/FAP-1; Polyclonal Antibody; PTPN13/FAP-1 Rabbit pAb; FAP; DPPIV; FAPA; FAPalpha; SIMP; prolyl endopeptidase FAP; anti-PTPN13/FAP-1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
Expressed in adipose tissue. Expressed in the dermal fibroblasts in the fetal skin. Expressed in the granulation tissue of healing wounds and on reactive stromal fibroblast in epithelial cancers. Expressed in activated fibroblast-like synoviocytes from inflamed synovial tissues. Expressed in activated hepatic stellate cells (HSC) and myofibroblasts from cirrhotic liver, but not detected in normal liver. Expressed in glioma cells (at protein level). Expressed in glioblastomas and glioma cells. Isoform 1 and isoform 2 are expressed in melanoma, carcinoma and fibroblast cell lines.
Purity/Purification
Affinity purified
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Applicable Applications for anti-PTPN13/FAP-1 antibody
Western Blot (WB), Immunocytochemistry (ICC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 26-280 of human FAP (NP_004451.2).LRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEV
Positive Control
Mouse heart
Conjugation
Unconjugated
Modification
Unmodified
Cell Position
Cell membrane, Cell projection, Cell surface, Cytoplasm, Membrane, Secreted, Single-pass type II membrane protein, Single-pass type II membrane protein, invadopodium membrane, lamellipodium membrane, ruffle membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot - FAP Polyclonal Antibody. Western blot analysis of extracts of mouse heart, using FAP antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Exposure time: 30s.)

Western Blot (WB) (Western blot - FAP Polyclonal Antibody. Western blot analysis of extracts of mouse heart, using FAP antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Exposure time: 30s.)

Immunofluorescence (IF)

(Immunofluorescence - FAP Polyclonal Antibody. Immunofluorescence analysis of U2OS cells using FAP antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence - FAP Polyclonal Antibody. Immunofluorescence analysis of U2OS cells using FAP antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-PTPN13/FAP-1 antibody
The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PTPN13/FAP-1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87,713 Da
NCBI Official Full Name
seprase
NCBI Official Synonym Full Names
fibroblast activation protein, alpha
NCBI Official Symbol
FAP
NCBI Official Synonym Symbols
FAPA; DPPIV
NCBI Protein Information
seprase; integral membrane serine protease; 170 kDa melanoma membrane-bound gelatinase
UniProt Protein Name
Seprase
UniProt Gene Name
FAP
UniProt Entry Name
SEPR_HUMAN

NCBI Description

The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

FAP: In association with DPP4 is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May have a role in tissue remodeling during development and wound healing, and may contribute to invasiveness in malignant cancers. Belongs to the peptidase S9B family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.14.5; Protease; EC 3.4.21.26; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q23

Cellular Component: extracellular space; focal adhesion; cell surface; lamellipodium; apical part of cell; cytoplasm; plasma membrane; integral to membrane

Molecular Function: integrin binding; protein dimerization activity; peptidase activity; protein binding; protein homodimerization activity; protease binding; dipeptidyl-peptidase activity; serine-type peptidase activity; metalloendopeptidase activity; serine-type endopeptidase activity; endopeptidase activity

Biological Process: proteolysis involved in cellular protein catabolic process; endothelial cell migration; angiogenesis; proteolysis; cell adhesion; regulation of fibrinolysis

Research Articles on PTPN13/FAP-1

Similar Products

Product Notes

The PTPN13/FAP-1 fap (Catalog #AAA4757653) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTPN13/FAP-1 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PTPN13/FAP-1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunocytochemistry (ICC), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:200. Researchers should empirically determine the suitability of the PTPN13/FAP-1 fap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTPN13/FAP-1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.