Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PTPN1 expression in transfected 293T cell line by PTPN1 polyclonal antibody. Lane 1: PTPN1 transfected lysate (50kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PTPN1 Polyclonal Antibody | anti-PTPN1 antibody

PTPN1 (Tyrosine-protein Phosphatase Non-receptor Type 1, Protein-tyrosine Phosphatase 1B, PTP-1B, PTP1B) APC

Gene Names
PTPN1; PTP1B
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PTPN1; Polyclonal Antibody; PTPN1 (Tyrosine-protein Phosphatase Non-receptor Type 1; Protein-tyrosine Phosphatase 1B; PTP-1B; PTP1B) APC; anti-PTPN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PTPN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PTPN1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PTPN1, aa1-435 (NP_002818.1).
Immunogen Sequence
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PTPN1 expression in transfected 293T cell line by PTPN1 polyclonal antibody. Lane 1: PTPN1 transfected lysate (50kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PTPN1 expression in transfected 293T cell line by PTPN1 polyclonal antibody. Lane 1: PTPN1 transfected lysate (50kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PTPN1 antibody
PTP1B is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP has been shown to act as a negative regulator of insulin signaling by dephosphorylating the phosphotryosine residues of insulin receptor kinase. This PTP was also reported to dephosphorylate epidermal growth factor receptor kinase, as well as JAK2 and TYK2 kinases, which implicated the role of this PTP in cell growth control, and cell response to interferon stimulation.
Product Categories/Family for anti-PTPN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,967 Da
NCBI Official Full Name
tyrosine-protein phosphatase non-receptor type 1
NCBI Official Synonym Full Names
protein tyrosine phosphatase, non-receptor type 1
NCBI Official Symbol
PTPN1
NCBI Official Synonym Symbols
PTP1B
NCBI Protein Information
tyrosine-protein phosphatase non-receptor type 1; protein tyrosine phosphatase 1B; protein-tyrosine phosphatase 1B; protein tyrosine phosphatase, placental
UniProt Protein Name
Tyrosine-protein phosphatase non-receptor type 1
Protein Family
UniProt Gene Name
PTPN1
UniProt Synonym Gene Names
PTP1B; PTP-1B
UniProt Entry Name
PTN1_HUMAN

NCBI Description

The protein encoded by this gene is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP has been shown to act as a negative regulator of insulin signaling by dephosphorylating the phosphotryosine residues of insulin receptor kinase. This PTP was also reported to dephosphorylate epidermal growth factor receptor kinase, as well as JAK2 and TYK2 kinases, which implicated the role of this PTP in cell growth control, and cell response to interferon stimulation. [provided by RefSeq, Jul 2008]

Uniprot Description

PTP1B: a non-receptor phospho-tyrosine protein phosphatase which acts as a regulator of endoplasmic reticulum unfolded protein response. Mediates dephosphorylation and inactivation of PERK. May play an important role in CKII- and p60c-src-induced signal transduction cascades. May regulate the EFNA5-EPHA3 signaling pathway which modulates cell reorganization and cell-cell repulsion. Negatively regulates insulin signaling by dephosphorylating the phosphotyrosine residues of insulin receptor. Also reported to dephosphorylate integrin, epidermal growth factor receptor, JAK2 and TYK2, regulating cell growth control and the cellular response to interferon. May regulate the hepatocyte growth factor receptor signaling pathway through dephosphorylation of MET. PTP1B knockout mice show resistance to dietary weight gain and enhanced insulin sensitivity, suggesting a possible role in treatment of obesity as well as type 2 diabetes.

Protein type: Protein phosphatase, tyrosine (non-receptor); Phosphatase; EC 3.1.3.48; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 20q13.1-q13.2

Cellular Component: endoplasmic reticulum; early endosome; plasma membrane; cytoplasmic vesicle; cytosol

Molecular Function: protein binding; enzyme binding; ephrin receptor binding; zinc ion binding; protein tyrosine phosphatase activity; receptor tyrosine kinase binding; protein kinase binding; insulin receptor binding

Biological Process: platelet activation; unfolded protein response, activation of signaling protein activity; negative regulation of vascular endothelial growth factor receptor signaling pathway; unfolded protein response; cytokine and chemokine mediated signaling pathway; regulation of endocytosis; actin cytoskeleton reorganization; insulin receptor signaling pathway; regulation of signal transduction; negative regulation of insulin receptor signaling pathway; blood coagulation

Disease: Diabetes Mellitus, Noninsulin-dependent

Research Articles on PTPN1

Similar Products

Product Notes

The PTPN1 ptpn1 (Catalog #AAA6391386) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTPN1 (Tyrosine-protein Phosphatase Non-receptor Type 1, Protein-tyrosine Phosphatase 1B, PTP-1B, PTP1B) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTPN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTPN1 ptpn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTPN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.