Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PTGIS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Rabbit PTGIS Polyclonal Antibody | anti-PTGIS antibody

PTGIS antibody - middle region

Gene Names
PTGIS; CYP8; PGIS; PTGI; CYP8A1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PTGIS; Polyclonal Antibody; PTGIS antibody - middle region; anti-PTGIS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS
Sequence Length
500
Applicable Applications for anti-PTGIS antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PTGIS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PTGIS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-PTGIS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Related Product Information for anti-PTGIS antibody
This is a rabbit polyclonal antibody against PTGIS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PTGIS is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
prostacyclin synthase
NCBI Official Synonym Full Names
prostaglandin I2 synthase
NCBI Official Symbol
PTGIS
NCBI Official Synonym Symbols
CYP8; PGIS; PTGI; CYP8A1
NCBI Protein Information
prostacyclin synthase
UniProt Protein Name
Prostacyclin synthase
Protein Family
UniProt Gene Name
PTGIS
UniProt Synonym Gene Names
CYP8; CYP8A1
UniProt Entry Name
PTGIS_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis. [provided by RefSeq, Jul 2008]

Uniprot Description

PTGIS: Catalyzes the isomerization of prostaglandin H2 to prostacyclin (= prostaglandin I2). Belongs to the cytochrome P450 family.

Protein type: EC 5.3.99.4; Endoplasmic reticulum; Isomerase; Membrane protein, integral; Lipid Metabolism - arachidonic acid

Chromosomal Location of Human Ortholog: 20q13.13

Cellular Component: extracellular space; endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane; caveola; nucleus

Molecular Function: protein binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen; iron ion binding; prostaglandin-I synthase activity; heme binding; monooxygenase activity

Biological Process: vitamin metabolic process; negative regulation of nitric oxide biosynthetic process; icosanoid metabolic process; cyclooxygenase pathway; prostaglandin biosynthetic process; positive regulation of angiogenesis; nicotinamide metabolic process; inhibition of NF-kappaB transcription factor; NAD metabolic process; xenobiotic metabolic process; negative regulation of inflammatory response; arachidonic acid metabolic process; water-soluble vitamin metabolic process

Disease: Hypertension, Essential

Research Articles on PTGIS

Similar Products

Product Notes

The PTGIS ptgis (Catalog #AAA3207342) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTGIS antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PTGIS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTGIS ptgis for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIYTDPEVFK YNRFLNPDGS EKKDFYKDGK RLKNYNMPWG AGHNHCLGRS. It is sometimes possible for the material contained within the vial of "PTGIS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.