Mouse anti-Human PTGIS Monoclonal Antibody | anti-PTGIS antibody

PTGIS (Prostacyclin Synthase, Prostaglandin I2 Synthase, CYP8, CYP8A1, MGC126858, MGC126860) (FITC)

Cat. Num. AAA6149117

• Gene Names: PTGIS; CYP8; PGIS; PTGI; CYP8A1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: PTGIS; Monoclonal Antibody; PTGIS (Prostacyclin Synthase; Prostaglandin I2 Synthase; CYP8; CYP8A1; MGC126858; MGC126860) (FITC); anti-PTGIS antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B11
• Specificity: Recognizes human PTGIS.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PTGIS antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa391-501, from human PTGIS (NP_000952) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRIRP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PTGIS expression in transfected 293T cell lineusing 132033. Lane 1: PTGIS transfected lysate (Predicted MW: 57.1kD. Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PTGIS is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-PTGIS antibody

CYP8A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis.

Product Categories/Family for anti-PTGIS antibody

Antibodies; Prostaglandins

NCBI and Uniprot Product Information

• NCBI GI #: 13699859
• NCBI GeneID: 5740
• NCBI Accession #: NP_000952
• NCBI GenBank Nucleotide #: NM_000961
• UniProt Accession #: Q16647
• Molecular Weight: 57kDa
• NCBI Official Full Name: prostacyclin synthase
• NCBI Official Synonym Full Names: prostaglandin I2 synthase
• NCBI Official Symbol: PTGIS
• NCBI Official Synonym Symbols: CYP8; PGIS; PTGI; CYP8A1
• NCBI Protein Information: prostacyclin synthase
• UniProt Protein Name: Prostacyclin synthase
• Protein Family: Prostacyclin synthase
• UniProt Gene Name: PTGIS
• UniProt Synonym Gene Names: CYP8; CYP8A1
• UniProt Entry Name: PTGIS_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis. [provided by RefSeq, Jul 2008]

Uniprot Description

PTGIS: Catalyzes the isomerization of prostaglandin H2 to prostacyclin (= prostaglandin I2). Belongs to the cytochrome P450 family.

Protein type: EC 5.3.99.4; Endoplasmic reticulum; Isomerase; Membrane protein, integral; Lipid Metabolism - arachidonic acid

Chromosomal Location of Human Ortholog: 20q13.13

Cellular Component: extracellular space; endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane; caveola; nucleus

Molecular Function: protein binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen; iron ion binding; prostaglandin-I synthase activity; heme binding; monooxygenase activity

Biological Process: vitamin metabolic process; negative regulation of nitric oxide biosynthetic process; icosanoid metabolic process; cyclooxygenase pathway; prostaglandin biosynthetic process; positive regulation of angiogenesis; nicotinamide metabolic process; inhibition of NF-kappaB transcription factor; NAD metabolic process; xenobiotic metabolic process; negative regulation of inflammatory response; arachidonic acid metabolic process; water-soluble vitamin metabolic process

Disease: Hypertension, Essential