Rabbit PSMC4 Polyclonal Antibody | anti-PSMC4 antibody

PSMC4 antibody - N-terminal region

Cat. Num. AAA3212949

• Gene Names: PSMC4; S6; RPT3; TBP7; TBP-7; MIP224
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: PSMC4; Polyclonal Antibody; PSMC4 antibody - N-terminal region; anti-PSMC4 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE
• Sequence Length: 418

• Applicable Applications for anti-PSMC4 antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMC4
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PSMC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Related Product Information for anti-PSMC4 antibody

This is a rabbit polyclonal antibody against PSMC4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Product Categories/Family for anti-PSMC4 antibody

Polyclonal; Drugs and Drug Metabolism; Various

NCBI and Uniprot Product Information

• NCBI GI #: 5729991
• NCBI GeneID: 5704
• NCBI Accession #: NP_006494
• NCBI GenBank Nucleotide #: NM_006503
• UniProt Accession #: P43686
• Molecular Weight: 47kDa
• NCBI Official Full Name: 26S proteasome regulatory subunit 6B isoform 1
• NCBI Official Synonym Full Names: proteasome 26S subunit, ATPase 4
• NCBI Official Symbol: PSMC4
• NCBI Official Synonym Symbols: S6; RPT3; TBP7; TBP-7; MIP224
• NCBI Protein Information: 26S proteasome regulatory subunit 6B
• UniProt Protein Name: 26S protease regulatory subunit 6B
• Protein Family: 26S protease regulatory
• UniProt Gene Name: PSMC4
• UniProt Synonym Gene Names: MIP224; TBP7; TBP-7
• UniProt Entry Name: PRS6B_HUMAN

NCBI Description

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the triple-A family of ATPases that is a component of the 19S regulatory subunit and plays a role in 26S proteasome assembly. The encoded protein interacts with gankyrin, a liver oncoprotein, and may also play a role in Parkinson's disease through interactions with synphilin-1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

RPT3: an ATPase subunit of the 26S proteasome. A member of the triple-A family of ATPases which have a chaperone-like activity. Interacts with an orphan member of the nuclear hormone receptor superfamily highly expressed in liver, and with gankyrin, a liver oncoprotein. The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Two splice variant isoforms have been described.

Protein type: Protease; Proteasome complex; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 19q13.11-q13.13

Cellular Component: proteasome complex; nucleoplasm; membrane; cytoplasm; inclusion body; nucleus; cytosol

Molecular Function: protein binding; ATPase activity; ATP binding

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; blastocyst development; protein polyubiquitination; viral reproduction; apoptosis; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; proteolysis; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; regulation of apoptosis; antigen processing and presentation of peptide antigen via MHC class I; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I; gene expression; mitotic cell cycle; regulation of amino acid metabolic process; negative regulation of apoptosis; G1/S transition of mitotic cell cycle