Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PSMB8 rabbit polyclonal antibody. Western Blot analysis of PSMB8 expression in human kidney.)

Rabbit anti-Human, Mouse PSMB8 Polyclonal Antibody | anti-PSMB8 antibody

PSMB8 (LMP7, PSMB5i, RING10, Y2, Proteasome Subunit beta Type-8, Low Molecular Mass Protein 7, Macropain Subunit C13, Multicatalytic Endopeptidase Complex Subunit C13, Proteasome Component C13, Proteasome Subunit beta-5i, Really Interesting New Gene 10 Pr

Gene Names
PSMB8; JMP; ALDD; LMP7; NKJO; D6S216; PSMB5i; RING10; D6S216E
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PSMB8; Polyclonal Antibody; PSMB8 (LMP7; PSMB5i; RING10; Y2; Proteasome Subunit beta Type-8; Low Molecular Mass Protein 7; Macropain Subunit C13; Multicatalytic Endopeptidase Complex Subunit C13; Proteasome Component C13; Proteasome Subunit beta-5i; Really Interesting New Gene 10 Pr; anti-PSMB8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PSMB8. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-PSMB8 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PSMB8, aa1-272 (NP_004150.1).
Immunogen Sequence
MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PSMB8 rabbit polyclonal antibody. Western Blot analysis of PSMB8 expression in human kidney.)

Western Blot (WB) (PSMB8 rabbit polyclonal antibody. Western Blot analysis of PSMB8 expression in human kidney.)

Western Blot (WB)

(PSMB8 rabbit polyclonal antibody. Western Blot analysis of PSMB8 expression in mouse liver.)

Western Blot (WB) (PSMB8 rabbit polyclonal antibody. Western Blot analysis of PSMB8 expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of PSMB8 expression in transfected 293T cell line by PSMB8 polyclonal antibody. Lane 1: PSMB8 transfected lysate (29.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PSMB8 expression in transfected 293T cell line by PSMB8 polyclonal antibody. Lane 1: PSMB8 transfected lysate (29.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PSMB8 antibody
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit.
Product Categories/Family for anti-PSMB8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,770 Da
NCBI Official Full Name
proteasome subunit beta type-8 isoform E1 proprotein
NCBI Official Synonym Full Names
proteasome (prosome, macropain) subunit, beta type, 8
NCBI Official Symbol
PSMB8
NCBI Official Synonym Symbols
JMP; ALDD; LMP7; NKJO; D6S216; PSMB5i; RING10; D6S216E
NCBI Protein Information
proteasome subunit beta type-8; large multifunctional peptidase 7; low molecular mass protein 7; low molecular weight protein 7; macropain subunit C13; multicatalytic endopeptidase complex subunit C13; protease component C13; proteasome (prosome, macropai
UniProt Protein Name
Proteasome subunit beta type-8
Protein Family
UniProt Gene Name
PSMB8
UniProt Synonym Gene Names
LMP7; PSMB5i; RING10; Y2
UniProt Entry Name
PSB8_HUMAN

NCBI Description

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit. [provided by RefSeq, Jul 2008]

Uniprot Description

PSMB8: a proteasomal protein of the T1B peptidase family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternatively spliced isoforms have been identified; both isoforms are processed to yield the same mature subunit.

Protein type: Protease; EC 3.4.25.1; Proteasome complex

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: proteasome complex; nucleoplasm; proteasome core complex; cytosol

Molecular Function: threonine endopeptidase activity; protein binding

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; fat cell differentiation; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; viral reproduction; apoptosis; cytokine and chemokine mediated signaling pathway; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; regulation of apoptosis; antigen processing and presentation of peptide antigen via MHC class I; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I; gene expression; mitotic cell cycle; regulation of amino acid metabolic process; G1/S transition of mitotic cell cycle; negative regulation of apoptosis

Disease: Autoinflammation, Lipodystrophy, And Dermatosis Syndrome

Research Articles on PSMB8

Similar Products

Product Notes

The PSMB8 psmb8 (Catalog #AAA6391135) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSMB8 (LMP7, PSMB5i, RING10, Y2, Proteasome Subunit beta Type-8, Low Molecular Mass Protein 7, Macropain Subunit C13, Multicatalytic Endopeptidase Complex Subunit C13, Proteasome Component C13, Proteasome Subunit beta-5i, Really Interesting New Gene 10 Pr reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PSMB8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PSMB8 psmb8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PSMB8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.