Western Blot (WB)
(Host: RabbitTarget Name: PSG1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human PSG1 Polyclonal Antibody | anti-PSG1 antibody
PSG1 Antibody - C-terminal region
Gene Names
PSG1; SP1; B1G1; PBG1; CD66f; PSBG1; PSG95; PSGGA; DHFRP2; PSBG-1; PSGIIA; FL-NCA-1/2; PS-beta-C/D; PS-beta-G-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PSG1; Polyclonal Antibody; PSG1 Antibody - C-terminal region; anti-PSG1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FTYYRSGEVLYLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSG
Sequence Length
167
Applicable Applications for anti-PSG1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PSG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PSG1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PSG1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PSG1 antibody
The human placenta is a multihormonal endocrine organ that produces hormones, enzymes, and other molecules that support fetal survival and development. Pregnancy-specific beta-1-glycoprotein (PSBG, PSG) is a major product of the syncytiotrophoblast, reaching concentrations of 100 to 290 mg/l at term in the serum of pregnant women (Horne et al., 1976 [PubMed 971765]). PSG is a member of the immunoglobulin (Ig) superfamily (Watanabe and Chou, 1988 [PubMed 3257488]; Streydio et al., 1988 [PubMed 3260773]).[supplied by OMIM, Oct 2009]
Product Categories/Family for anti-PSG1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47 kDa
NCBI Official Full Name
pregnancy-specific beta-1-glycoprotein 1 isoform 2
NCBI Official Synonym Full Names
pregnancy specific beta-1-glycoprotein 1
NCBI Official Symbol
PSG1
NCBI Official Synonym Symbols
SP1; B1G1; PBG1; CD66f; PSBG1; PSG95; PSGGA; DHFRP2; PSBG-1; PSGIIA; FL-NCA-1/2; PS-beta-C/D; PS-beta-G-1
NCBI Protein Information
pregnancy-specific beta-1-glycoprotein 1
UniProt Protein Name
Pregnancy-specific beta-1-glycoprotein 1
Protein Family
UniProt Gene Name
PSG1
UniProt Synonym Gene Names
B1G1; PSBG1; PSGGA; PS-beta-G-1; PSBG-1; Pregnancy-specific glycoprotein 1; FL-NCA-1/2; PS-beta-C/D
UniProt Entry Name
PSG1_HUMAN
NCBI Description
The human placenta is a multihormonal endocrine organ that produces hormones, enzymes, and other molecules that support fetal survival and development. Pregnancy-specific beta-1-glycoprotein (PSBG, PSG) is a major product of the syncytiotrophoblast, reaching concentrations of 100 to 290 mg/l at term in the serum of pregnant women (Horne et al., 1976 [PubMed 971765]). PSG is a member of the immunoglobulin (Ig) superfamily (Watanabe and Chou, 1988 [PubMed 3257488]; Streydio et al., 1988 [PubMed 3260773]).[supplied by OMIM, Oct 2009]
Uniprot Description
PSG1: Belongs to the immunoglobulin superfamily. CEA family. 4 isoforms of the human protein are produced by alternative splicing
Protein type: Secreted, signal peptide; Secreted
Chromosomal Location of Human Ortholog: 19q13.2
Cellular Component: extracellular region
Biological Process: female pregnancy
Research Articles on PSG1
Similar Products
Product Notes
The PSG1 psg1 (Catalog #AAA3220380) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSG1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PSG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PSG1 psg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTYYRSGEVL YLSCSADSNP PAQYSWTINE KFQLPGQKLF IRHITTKHSG. It is sometimes possible for the material contained within the vial of "PSG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
