Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PRUNESample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PRUNE1 Polyclonal Antibody | anti-PRUNE1 antibody

PRUNE1 Antibody - C-terminal region

Gene Names
PRUNE1; PRUNE; DRES17; HTCD37; NMIHBA; DRES-17; H-PRUNE
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PRUNE1; Polyclonal Antibody; PRUNE1 Antibody - C-terminal region; anti-PRUNE1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVD
Sequence Length
386
Applicable Applications for anti-PRUNE1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRUNE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PRUNESample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PRUNESample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PRUNE1 antibody
This is a rabbit polyclonal antibody against PRUNE. It was validated on Western Blot

Target Description: This gene encodes a member of the DHH protein superfamily of phosphoesterases. This protein has been found to function as both a nucleotide phosphodiesterase and an exopolyphosphatase. This protein is believed to stimulate cancer progression and metastases through the induction of cell motility. A pseuodgene has been identified on chromosome 13. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-PRUNE1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
exopolyphosphatase PRUNE1 isoform 1
NCBI Official Synonym Full Names
prune exopolyphosphatase 1
NCBI Official Symbol
PRUNE1
NCBI Official Synonym Symbols
PRUNE; DRES17; HTCD37; NMIHBA; DRES-17; H-PRUNE
NCBI Protein Information
exopolyphosphatase PRUNE1
UniProt Protein Name
Protein prune homolog
UniProt Gene Name
PRUNE
UniProt Synonym Gene Names
hPrune; DRES-17; DRES17
UniProt Entry Name
PRUNE_HUMAN

NCBI Description

This gene encodes a member of the DHH protein superfamily of phosphoesterases. This protein has been found to function as both a nucleotide phosphodiesterase and an exopolyphosphatase. This protein is believed to stimulate cancer progression and metastases through the induction of cell motility. A pseuodgene has been identified on chromosome 13. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

Uniprot Description

PRUNE: Phosphodiesterase (PDE) that has higher activity toward cAMP than cGMP, as substrate. Plays a role in cell proliferation, is able to induce cell motility and acts as a negative regulator of NME1. Belongs to the PPase class C family. Prune subfamily. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Nucleotide Metabolism - purine; EC 3.6.1.1

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: focal adhesion; cytoplasm; nucleus

Molecular Function: protein binding; inorganic diphosphatase activity; metal ion binding

Biological Process: metabolic process

Research Articles on PRUNE1

Similar Products

Product Notes

The PRUNE1 prune (Catalog #AAA3219554) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRUNE1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRUNE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRUNE1 prune for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IPSGQPETAD VSREQVDKEL DRASNSLISG LSQDEEDPPL PPTPMNSLVD. It is sometimes possible for the material contained within the vial of "PRUNE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.