Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PRSS2Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PRSS2 Polyclonal Antibody | anti-PRSS2 antibody

PRSS2 Antibody - middle region

Gene Names
PRSS2; TRY2; TRY8; TRYP2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PRSS2; Polyclonal Antibody; PRSS2 Antibody - middle region; anti-PRSS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTA
Sequence Length
247
Applicable Applications for anti-PRSS2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PRSS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PRSS2Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PRSS2Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PRSS2 antibody
This gene belongs to the trypsin family of serine proteases and encodes anionic trypsinogen. It is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. Enzymes of this family cleave peptide bonds that follow lysine or arginine residues. This protein is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. This protein has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion. In addition, this enzyme is able to cleave across the type II collagen triple helix in rheumatoid arthritis synovitis tissue, potentially participating in the degradation of type II collagen-rich cartilage matrix. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27 kDa
NCBI Official Full Name
trypsin-2 isoform 2 preproprotein
NCBI Official Synonym Full Names
serine protease 2
NCBI Official Symbol
PRSS2
NCBI Official Synonym Symbols
TRY2; TRY8; TRYP2
NCBI Protein Information
trypsin-2
UniProt Protein Name
Trypsin-2
Protein Family
UniProt Gene Name
PRSS2
UniProt Synonym Gene Names
TRY2; TRYP2
UniProt Entry Name
TRY2_HUMAN

NCBI Description

This gene belongs to the trypsin family of serine proteases and encodes anionic trypsinogen. It is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. Enzymes of this family cleave peptide bonds that follow lysine or arginine residues. This protein is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. This protein has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion. In addition, this enzyme is able to cleave across the type II collagen triple helix in rheumatoid arthritis synovitis tissue, potentially participating in the degradation of type II collagen-rich cartilage matrix. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2015]

Uniprot Description

trypsin 2: In the ileum, may be involved in defensin processing, including DEFA5. Belongs to the peptidase S1 family.

Protein type: Secreted; Extracellular matrix; Secreted, signal peptide; Calcium-binding; EC 3.4.21.4; Protease; Cell adhesion

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: extracellular matrix; extracellular space; extracellular region

Molecular Function: protein binding; serine-type endopeptidase activity; calcium ion binding

Biological Process: extracellular matrix disassembly; collagen catabolic process; extracellular matrix organization and biogenesis; positive regulation of cell adhesion; digestion; innate immune response; proteolysis; positive regulation of cell growth

Disease: Pancreatitis, Hereditary

Research Articles on PRSS2

Similar Products

Product Notes

The PRSS2 prss2 (Catalog #AAA3221348) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRSS2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRSS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRSS2 prss2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EGNEQFINAA KIIRHPKYNS RTLDNDILLI KLSSPAVINS RVSAISLPTA. It is sometimes possible for the material contained within the vial of "PRSS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.