Rabbit anti-Human PRPF4B Polyclonal Antibody | anti-PRPF4B antibody
PRPF4B Polyclonal Antibody
Gene Names
PRPF4B; PR4H; PRP4; PRP4H; PRP4K; dJ1013A10.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
PRPF4B; Polyclonal Antibody; PRPF4B Polyclonal Antibody; dJ1013A10.1; PR4H; PRP4; PRP4H; PRP4K; anti-PRPF4B antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
QKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHK
Sequence Length
1007
Applicable Applications for anti-PRPF4B antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human PRPF4B
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-PRPF4B antibody
Pre-mRNA splicing occurs in two sequential transesterification steps, and the protein encoded by this gene is thought to be involved in pre-mRNA splicing and in signal transduction. This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs). This protein is regarded as a CDK-like kinase (Clk) with homology to mitogen-activated protein kinases (MAPKs).
Product Categories/Family for anti-PRPF4B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
116kDa
NCBI Official Full Name
serine/threonine-protein kinase PRP4 homolog
NCBI Official Synonym Full Names
pre-mRNA processing factor 4B
NCBI Official Symbol
PRPF4B
NCBI Official Synonym Symbols
PR4H; PRP4; PRP4H; PRP4K; dJ1013A10.1
NCBI Protein Information
serine/threonine-protein kinase PRP4 homolog
UniProt Protein Name
Serine/threonine-protein kinase PRP4 homolog
Protein Family
UniProt Gene Name
PRPF4B
UniProt Synonym Gene Names
KIAA0536; PRP4; PRP4H; PRP4K
NCBI Description
Pre-mRNA splicing occurs in two sequential transesterification steps, and the protein encoded by this gene is thought to be involved in pre-mRNA splicing and in signal transduction. This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs). This protein is regarded as a CDK-like kinase (Clk) with homology to mitogen-activated protein kinases (MAPKs). [provided by RefSeq, Jul 2008]
Uniprot Description
Has a role in pre-mRNA splicing. Phosphorylates SF2/ASF.
Research Articles on PRPF4B
Similar Products
Product Notes
The PRPF4B prpf4b (Catalog #AAA9134807) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRPF4B Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRPF4B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the PRPF4B prpf4b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QKYKYLAEDS NMSVPSEPSS PQSSTRTRSP SPDDILERVA ADVKEYEREN VDTFEASVKA KHNLMTVEQN NGSSQKKLLA PDMFTESDDM FAAYFDSARL RAAGIGKDFK ENPNLRDNWT DAEGYYRVNI GEVLDKRYNV YGYTGQGVFS NVVRARDNAR ANQEVAVKII RNNELMQKTG LKELEFLKKL NDADPDDKFH CLRLFRHFYH K. It is sometimes possible for the material contained within the vial of "PRPF4B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
