Western Blot (WB)
(Western Blot: Sample: Recombinant protein.)
Rabbit anti-Mouse Protein Kinase C Alpha (PKCa) Polyclonal Antibody | anti-PKCa antibody
Polyclonal Antibody to Protein Kinase C Alpha (PKCa)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-FN FLMVLGKGSF GKVMLADRKG TEELYAIKIL KKDVVIQDDD VECTMVEKRV LALLDKPPFL TQLHSCFQTV DRLYFVMEYV NGGDLMYHIQ QVGKFKEPQA VFYAAEISIG LFFLHKRGII YRDLKLNNVM LNSEGHIKIA DFGMCKEHMM DGVTTRTFCG TPDYIAPEII AYQPYGKSVD WWAYGVLLYE MLAGQPPFDG EDEDELFQSI MEHNVSYPKS LSKEAVSICK GLMTKQPAKR LGCGPEGERD VREHAFF
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Western Blot (WB)
(Western Blot: Sample: Recombinant protein.)
Western Blot (WB)
(Western Blot: Sample: Recombinant protein.)
Immunohistochemistry (IHC)
(DAB staining on fromalin fixed paraffin-embedded kidney tissue))
Immunohistochemistry (IHC)
(DAB staining on fromalin fixed paraffin-embedded kidney tissue))
NCBI and Uniprot Product Information
Uniprot Description
PKCA: an AGC kinase of the PKC family. A classical PKC downstream of many mitogenic and receptors. Classical PKCs are calcium-dependent enzymes that are activated by phosphatidylserine, diacylglycerol and phorbol esters. Contains a pseudo-substrate autoinhibitory domain that binds to the catalytic domain preventing its activation in the absence of cofactors or activators.
Protein type: AGC group; Alpha subfamily; EC 2.7.11.13; Kinase, protein; Oncoprotein; PKC family; Protein kinase, AGC; Protein kinase, Ser/Thr (non-receptor)
Chromosomal Location of Human Ortholog: 11 E1|11 70.8 cM
Cellular Component: apical part of cell; axon; cell soma; cytoplasm; cytosol; dendrite; endoplasmic reticulum; extracellular exosome; membrane; membrane raft; mitochondrion; neuron projection; nucleus; perinuclear region of cytoplasm; photoreceptor outer segment; plasma membrane; protein complex
Molecular Function: ATP binding; calcium-dependent protein kinase C activity; enzyme binding; kinase activity; metal ion binding; nucleotide binding; protein binding; protein kinase activity; protein kinase C activity; protein serine/threonine kinase activity; transferase activity; zinc ion binding
Biological Process: angiogenesis; apoptosis; cell adhesion; cellular calcium ion homeostasis; cellular response to carbohydrate stimulus; central nervous system neuron axonogenesis; chondrocyte differentiation; inactivation of MAPK activity; induction of positive chemotaxis; learning and/or memory; negative regulation of anion channel activity; negative regulation of cell proliferation; negative regulation of glucose import; negative regulation of heart contraction; negative regulation of insulin receptor signaling pathway; negative regulation of protein kinase activity; negative regulation of protein phosphorylation; negative regulation of translation; neutrophil chemotaxis; peptidyl-serine phosphorylation; peptidyl-threonine phosphorylation; phosphorylation; positive regulation of angiogenesis; positive regulation of blood vessel endothelial cell migration; positive regulation of cardiac muscle hypertrophy; positive regulation of cell adhesion; positive regulation of cell migration; positive regulation of dense core granule biogenesis; positive regulation of endothelial cell migration; positive regulation of endothelial cell proliferation; positive regulation of ERK1 and ERK2 cascade; positive regulation of exocytosis; positive regulation of inflammatory response; positive regulation of lipopolysaccharide-mediated signaling pathway; positive regulation of macrophage differentiation; positive regulation of mitotic cell cycle; positive regulation of protein phosphorylation; positive regulation of smooth muscle cell proliferation; positive regulation of synaptogenesis; protein amino acid phosphorylation; protein autophosphorylation; regulation of muscle contraction; regulation of peptidyl-tyrosine phosphorylation; regulation of platelet aggregation; regulation of receptor-mediated endocytosis; regulation of response to osmotic stress; regulation of the force of heart contraction; response to estradiol; response to ethanol; response to reactive oxygen species
Research Articles on PKCa
Similar Products
Product Notes
The PKCa prkca (Catalog #AAA2001863) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Protein Kinase C Alpha (PKCa) reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Protein Kinase C Alpha (PKCa) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the PKCa prkca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-FN FLMVLGKGSF GKVMLADRKG TEELYAIKIL KKDVVIQDDD VECTMVEKRV LALLDKPPFL TQLHSCFQTV DRLYFVMEYV NGGDLMYHIQ QVGKFKEPQA VFYAAEISIG LFFLHKRGII YRDLKLNNVM LNSEGHIKIA DFGMCKEHMM DGVTTRTFCG TPDYIAPEII AYQPYGKSVD WWAYGVLLYE MLAGQPPFDG EDEDELFQSI MEHNVSYPKS LSKEAVSICK GLMTKQPAKR LGCGPEGERD VREHAFF. It is sometimes possible for the material contained within the vial of "Protein Kinase C Alpha (PKCa), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
