Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PRODSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PRODH Polyclonal Antibody | anti-PRODH antibody

PRODH Antibody - N-terminal region

Gene Names
PRODH; POX; PIG6; HSPOX2; PRODH1; PRODH2; TP53I6
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRODH; Polyclonal Antibody; PRODH Antibody - N-terminal region; anti-PRODH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EAEHKEMESCTSAAERDGSGTNKRDKQYQAHRAFGDRRNGVISARTYFYA
Sequence Length
600
Applicable Applications for anti-PRODH antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PROD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PRODSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PRODSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PRODH antibody
This is a rabbit polyclonal antibody against PROD. It was validated on Western Blot

Target Description: This gene encodes a mitochondrial protein that catalyzes the first step in proline degradation. Mutations in this gene are associated with hyperprolinemia type 1 and susceptibility to schizophrenia 4 (SCZD4). This gene is located on chromosome 22q11.21, a region which has also been associated with the contiguous gene deletion syndromes, DiGeorge and CATCH22. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PRODH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
proline dehydrogenase 1, mitochondrial isoform 1
NCBI Official Synonym Full Names
proline dehydrogenase 1
NCBI Official Symbol
PRODH
NCBI Official Synonym Symbols
POX; PIG6; HSPOX2; PRODH1; PRODH2; TP53I6
NCBI Protein Information
proline dehydrogenase 1, mitochondrial
UniProt Protein Name
Proline dehydrogenase 1, mitochondrial
UniProt Gene Name
PRODH
UniProt Synonym Gene Names
PIG6; POX2
UniProt Entry Name
PROD_HUMAN

NCBI Description

This gene encodes a mitochondrial protein that catalyzes the first step in proline degradation. Mutations in this gene are associated with hyperprolinemia type 1 and susceptibility to schizophrenia 4 (SCZD4). This gene is located on chromosome 22q11.21, a region which has also been associated with the contiguous gene deletion syndromes, DiGeorge and CATCH22. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2010]

Uniprot Description

PRODH: Converts proline to delta-1-pyrroline-5-carboxylate. Defects in PRODH are the cause of hyperprolinemia type 1 (HP-1). HP-1 is a disorder characterized by elevated serum proline levels. May be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome. Defects in PRODH are associated with susceptibility to schizophrenia type 4 (SCZD4). A complex, multifactorial psychotic disorder or group of disorders characterized by disturbances in the form and content of thought (e.g. delusions, hallucinations), in mood (e.g. inappropriate affect), in sense of self and relationship to the external world (e.g. loss of ego boundaries, withdrawal), and in behavior (e.g bizarre or apparently purposeless behavior). Although it affects emotions, it is distinguished from mood disorders in which such disturbances are primary. Similarly, there may be mild impairment of cognitive function, and it is distinguished from the dementias in which disturbed cognitive function is considered primary. Some patients manifest schizophrenic as well as bipolar disorder symptoms and are often given the diagnosis of schizoaffective disorder. Belongs to the proline oxidase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - arginine and proline; Oxidoreductase; Mitochondrial; EC 1.5.5.2

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: mitochondrial matrix; mitochondrial inner membrane

Molecular Function: proline dehydrogenase activity

Biological Process: proline catabolic process; 4-hydroxyproline catabolic process; induction of apoptosis by oxidative stress; proline catabolic process to glutamate; proline metabolic process

Disease: Hyperprolinemia, Type I; Schizophrenia 4

Research Articles on PRODH

Similar Products

Product Notes

The PRODH prodh (Catalog #AAA3219551) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRODH Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRODH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRODH prodh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EAEHKEMESC TSAAERDGSG TNKRDKQYQA HRAFGDRRNG VISARTYFYA. It is sometimes possible for the material contained within the vial of "PRODH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.