Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti-PRLR Picoband antibody, MBS177903, Western blottingAll lanes: Anti PRLR (MBS177903) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: SGC Whole Cell Lysate at 40ugLane 3: SW620 Whole Cell Lysate at 40ugPredicted bind size: 90KDObserved bind size: 90KD )

anti-Human PRLR Polyclonal Antibody | anti-PRLR antibody

Anti-PRLR Antibody

Gene Names
PRLR; HPRL; MFAB; hPRLrI
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
PRLR; Polyclonal Antibody; Anti-PRLR Antibody; Prolactin receptor; AI987712; CLONE SPM213; CPRLP; Delta 4-delta 7/11 truncated prolactin receptor; Delta 4-SF1b truncated prolactin receptor; hPRL receptor; hPRLrI; Lactogen receptor; MGC105486; OPR; OTTHUMP00000115998; Pr-1; Pr-3; PRL R; PRL-R; Prlr-rs1; PRLR_HUMAN; Prolactin receptor a; Prolactin receptor delta 7/11; RATPRLR; Secreted prolactin binding protein; Truncated testis-specific box 1-C prolactin receptor; wu:fj65c07 antibody; prolactin receptor; anti-PRLR antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
622
Applicable Applications for anti-PRLR antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PRLR (565-605aa HAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQ), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by fourteen amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti-PRLR Picoband antibody, MBS177903, Western blottingAll lanes: Anti PRLR (MBS177903) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: SGC Whole Cell Lysate at 40ugLane 3: SW620 Whole Cell Lysate at 40ugPredicted bind size: 90KDObserved bind size: 90KD )

Western Blot (WB) (Anti-PRLR Picoband antibody, MBS177903, Western blottingAll lanes: Anti PRLR (MBS177903) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: SGC Whole Cell Lysate at 40ugLane 3: SW620 Whole Cell Lysate at 40ugPredicted bind size: 90KDObserved bind size: 90KD )
Related Product Information for anti-PRLR antibody
Description: Rabbit IgG polyclonal antibody for Prolactin receptor(PRLR) detection. Tested with WB in Human.

Background: PRLR (Prolactin Receptor) is a cytokine receptor. By somatic cell hybrid analysis and by in situ hybridization, Arden et al. (1989, 1990) demonstrated that the prolactin receptor gene resides in the same chromosomal region as the growth hormone receptor gene, which has been mapped to 5p13-p12. Cunningham et al. (1990) demonstrated that zinc greatly increases the affinity of GH for the extracellular binding domain of PRLR, although it is not required for binding of GH to the growth hormone receptor or for binding of prolactin to the prolactin receptor. By mutational analysis, they showed that a cluster of 3 residues (histidine-18, histidine-21, and glutamic acid-174) in GH and histidine-188 in PRLR (conserved in all PRL receptors but not GH receptors) are likely zinc-ion ligands.
References
1. Arden, K. C., Boutin, J.-M., Djiane, J., Kelly, P. A., Cavenee, W. K. The receptors for prolactin and growth hormone are localized in the same region of human chromosome 5. Cytogenet. Cell Genet. 53: 161-165, 1990. 2. Arden, K. C., Cavenee, W. K., Boutin, J.-M., Kelly, P. A. The genes encoding the receptors for prolactin and growth hormone map to human chromosome 5. (Abstract) Am. J. Hum. Genet. 45 (suppl.): A129 only, 1989. 3. Cunningham, B. C., Bass, S., Fuh, G., Wells, J. A. Zinc mediation of the binding of human growth hormone to the human prolactin receptor. Science 250: 1709-1712, 1990.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,011 Da
NCBI Official Full Name
prolactin receptor isoform 1
NCBI Official Synonym Full Names
prolactin receptor
NCBI Official Symbol
PRLR
NCBI Official Synonym Symbols
HPRL; MFAB; hPRLrI
NCBI Protein Information
prolactin receptor
UniProt Protein Name
Prolactin receptor
Protein Family
UniProt Gene Name
PRLR
UniProt Synonym Gene Names
PRL-R
UniProt Entry Name
PRLR_HUMAN

NCBI Description

This gene encodes a receptor for the anterior pituitary hormone, prolactin, and belongs to the type I cytokine receptor family. Prolactin-dependent signaling occurs as the result of ligand-induced dimerization of the prolactin receptor. Several alternatively spliced transcript variants encoding different membrane-bound and soluble isoforms have been described for this gene, which may function to modulate the endocrine and autocrine effects of prolactin in normal tissue and cancer. [provided by RefSeq, Feb 2011]

Uniprot Description

PRLR: receptor for the anterior pituitary hormone prolactin and placental lactogen I and II. Interacts with Cyclophilin A, differentially regulating various signaling pathways from the PrlR. Prolactin signaling is attenuated by threonine and tyrosine phosphorylation. Two alternative splice isoforms have been identified.

Protein type: Receptor, cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 5p13.2

Cellular Component: cell surface; extracellular region; integral to membrane; plasma membrane

Molecular Function: metal ion binding; ornithine decarboxylase activator activity; peptide hormone binding; prolactin receptor activity; protein binding; protein homodimerization activity

Biological Process: cell surface receptor linked signal transduction; embryo implantation; lactation; negative regulation of apoptosis; regulation of cell adhesion; regulation of epithelial cell differentiation; steroid biosynthetic process; T cell activation; transmembrane receptor protein tyrosine kinase activation (dimerization); tyrosine phosphorylation of JAK2 protein

Disease: Hyperprolactinemia; Multiple Fibroadenomas Of The Breast

Research Articles on PRLR

Similar Products

Product Notes

The PRLR prlr (Catalog #AAA177903) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-PRLR Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRLR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the PRLR prlr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRLR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.