Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: PRKAR1BSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Rabbit PRKAR1B Polyclonal Antibody | anti-PRKAR1B antibody

PRKAR1B antibody - middle region

Gene Names
PRKAR1B; PRKAR1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRKAR1B; Polyclonal Antibody; PRKAR1B antibody - middle region; anti-PRKAR1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT
Sequence Length
381
Applicable Applications for anti-PRKAR1B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Sheep: 85%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PRKAR1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: PRKAR1BSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: PRKAR1BSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PRKAR1BSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PRKAR1BSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-PRKAR1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-PRKAR1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)
Related Product Information for anti-PRKAR1B antibody
This is a rabbit polyclonal antibody against PRKAR1B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion
Product Categories/Family for anti-PRKAR1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
cAMP-dependent protein kinase type I-beta regulatory subunit
NCBI Official Synonym Full Names
protein kinase cAMP-dependent type I regulatory subunit beta
NCBI Official Symbol
PRKAR1B
NCBI Official Synonym Symbols
PRKAR1
NCBI Protein Information
cAMP-dependent protein kinase type I-beta regulatory subunit
UniProt Protein Name
cAMP-dependent protein kinase type I-beta regulatory subunit
UniProt Gene Name
PRKAR1B
UniProt Entry Name
KAP1_HUMAN

NCBI Description

The protein encoded by this gene is a regulatory subunit of cyclic AMP-dependent protein kinase A (PKA), which is involved in the signaling pathway of the second messenger cAMP. Two regulatory and two catalytic subunits form the PKA holoenzyme, disbands after cAMP binding. The holoenzyme is involved in many cellular events, including ion transport, metabolism, and transcription. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2015]

Uniprot Description

PKAR1B: Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells. The inactive holoenzyme is composed of two regulatory chains and two catalytic chains. Activation by cAMP releases the two active catalytic monomers and the regulatory dimer. Interacts with PRKX; regulates this cAMP-dependent protein kinase. Four types of regulatory chains are found: I- alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible. Belongs to the cAMP-dependent kinase regulatory chain family.

Protein type: Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: 7p22

Cellular Component: plasma membrane; cytosol; cAMP-dependent protein kinase complex

Molecular Function: cAMP-dependent protein kinase inhibitor activity; cAMP-dependent protein kinase regulator activity; cAMP binding

Biological Process: epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; water transport; activation of protein kinase A; signal transduction; protein amino acid phosphorylation; learning and/or memory; phospholipase C activation; energy reserve metabolic process; innate immune response; renal water homeostasis; blood coagulation; regulation of insulin secretion; transmembrane transport

Research Articles on PRKAR1B

Similar Products

Product Notes

The PRKAR1B prkar1b (Catalog #AAA3212760) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKAR1B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PRKAR1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRKAR1B prkar1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LNRPRAATVV ARGPLKCVKL DRPRFERVLG PCSEILKRNI QRYNSFISLT. It is sometimes possible for the material contained within the vial of "PRKAR1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.