Rabbit anti-Human PRKACA Polyclonal Antibody | anti-PRKACA antibody

PRKACA Antibody - N-terminal region

Cat. Num. AAA3223500

• Gene Names: PRKACA; PKACA; PPNAD4
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: PRKACA; Polyclonal Antibody; PRKACA Antibody - N-terminal region; anti-PRKACA antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: FLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILD
• Sequence Length: 351

• Applicable Applications for anti-PRKACA antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKACA
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PRKACASample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-PRKACA antibody

This gene encodes one of the catalytic subunits of protein kinase A, which exists as a tetrameric holoenzyme with two regulatory subunits and two catalytic subunits, in its inactive form. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. cAMP-dependent phosphorylation of proteins by protein kinase A is important to many cellular processes, including differentiation, proliferation, and apoptosis. Constitutive activation of this gene caused either by somatic mutations, or genomic duplications of regions that include this gene, have been associated with hyperplasias and adenomas of the adrenal cortex and are linked to corticotropin-independent Cushing's syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. Tissue-specific isoforms that differ at the N-terminus have been described, and these isoforms may differ in the post-translational modifications that occur at the N-terminus of some isoforms.

Product Categories/Family for anti-PRKACA antibody

Polyclonal; Cancer; Protein Kinases; Apoptosis; Disease Related; Meiosis/Mitosis/Cell Cycle; Tissue Specific & Cell Marker

NCBI and Uniprot Product Information

• NCBI GI #: 748585205
• NCBI GeneID: 5566
• NCBI Accession #: NP_001291278.1
• NCBI GenBank Nucleotide #: NM_001304349.1
• UniProt Accession #: P17612
• Molecular Weight: 41 kDa
• NCBI Official Full Name: cAMP-dependent protein kinase catalytic subunit alpha isoform 3
• NCBI Official Synonym Full Names: protein kinase cAMP-activated catalytic subunit alpha
• NCBI Official Symbol: PRKACA
• NCBI Official Synonym Symbols: PKACA; PPNAD4
• NCBI Protein Information: cAMP-dependent protein kinase catalytic subunit alpha
• UniProt Protein Name: cAMP-dependent protein kinase catalytic subunit alpha
• Protein Family: cAMP-dependent protein kinase
• UniProt Gene Name: PRKACA
• UniProt Synonym Gene Names: PKACA; PKA C-alpha
• UniProt Entry Name: KAPCA_HUMAN

NCBI Description

This gene encodes one of the catalytic subunits of protein kinase A, which exists as a tetrameric holoenzyme with two regulatory subunits and two catalytic subunits, in its inactive form. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. cAMP-dependent phosphorylation of proteins by protein kinase A is important to many cellular processes, including differentiation, proliferation, and apoptosis. Constitutive activation of this gene caused either by somatic mutations, or genomic duplications of regions that include this gene, have been associated with hyperplasias and adenomas of the adrenal cortex and are linked to corticotropin-independent Cushing's syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. Tissue-specific isoforms that differ at the N-terminus have been described, and these isoforms may differ in the post-translational modifications that occur at the N-terminus of some isoforms. [provided by RefSeq, Jan 2015]