Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-PRDX3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit anti-Human PRDX3 Polyclonal Antibody | anti-PRDX3 antibody

PRDX3 antibody - N-terminal region

Gene Names
PRDX3; AOP1; MER5; AOP-1; SP-22; HBC189; PRO1748; prx-III
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PRDX3; Polyclonal Antibody; PRDX3 antibody - N-terminal region; anti-PRDX3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS
Sequence Length
238
Applicable Applications for anti-PRDX3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PRDX3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PRDX3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-PRDX3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-PRDX3 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysatePRDX3 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-PRDX3 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysatePRDX3 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-PRDX3 antibody
This is a rabbit polyclonal antibody against PRDX3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PRDX3 is a protein with antioxidant function and is localized in the mitochondrion. Expression of this gene product in E. coli deficient in the C22-subunit gene rescued resistance of the bacteria to alkylhydroperoxide. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologues suggest that these genes consist of a family that is responsible for regulation of cellular proliferation, differentiation, and antioxidant functions. This gene encodes a protein with antioxidant function and is localized in the mitochondrion. This gene shows significant nucleotide sequence similarity to the gene coding for the C22 subunit of Salmonella typhimurium alkylhydroperoxide reductase. Expression of this gene product in E. coli deficient in the C22-subunit gene rescued resistance of the bacteria to alkylhydroperoxide. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologues suggest that these genes consist of a family that is responsible for regulation of cellular proliferation, differentiation, and antioxidant functions. Two transcript variants encoding two different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Synonym Full Names
peroxiredoxin 3
NCBI Official Symbol
PRDX3
NCBI Official Synonym Symbols
AOP1; MER5; AOP-1; SP-22; HBC189; PRO1748; prx-III
NCBI Protein Information
thioredoxin-dependent peroxide reductase, mitochondrial
UniProt Protein Name
Thioredoxin-dependent peroxide reductase, mitochondrial
UniProt Gene Name
PRDX3
UniProt Synonym Gene Names
AOP1; AOP-1; Prx-III
UniProt Entry Name
PRDX3_HUMAN

NCBI Description

This gene encodes a mitochondrial protein with antioxidant function. The protein is similar to the C22 subunit of Salmonella typhimurium alkylhydroperoxide reductase, and it can rescue bacterial resistance to alkylhydroperoxide in E. coli that lack the C22 subunit. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologs suggest that these genes consist of a family that is responsible for the regulation of cellular proliferation, differentiation and antioxidant functions. This family member can protect cells from oxidative stress, and it can promote cell survival in prostate cancer. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 3, 13 and 22. [provided by RefSeq, Oct 2014]

Uniprot Description

PRDX3: Involved in redox regulation of the cell. Protects radical-sensitive enzymes from oxidative damage by a radical- generating system. Acts synergistically with MAP3K13 to regulate the activation of NF-kappa-B in the cytosol. Belongs to the AhpC/TSA family.

Protein type: Oxidoreductase; EC 1.11.1.15

Chromosomal Location of Human Ortholog: 10q25-q26

Cellular Component: mitochondrion; mitochondrial matrix; cytoplasm; early endosome; IkappaB kinase complex; cytosol

Molecular Function: protein C-terminus binding; identical protein binding; protein binding; thioredoxin peroxidase activity; caspase inhibitor activity; alkyl hydroperoxide reductase activity; kinase binding; protein kinase binding

Biological Process: negative regulation of kinase activity; mitochondrion organization and biogenesis; response to lipopolysaccharide; negative regulation of caspase activity; activation of NF-kappaB transcription factor; response to reactive oxygen species; peptidyl-cysteine oxidation; response to hydrogen peroxide; regulation of mitochondrial membrane potential; hydrogen peroxide catabolic process; positive regulation of cell proliferation; myeloid cell differentiation; response to oxidative stress; negative regulation of apoptosis; maternal placenta development

Research Articles on PRDX3

Similar Products

Product Notes

The PRDX3 prdx3 (Catalog #AAA3210743) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRDX3 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRDX3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PRDX3 prdx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AIPWGISATA ALRPAACGRT SLTNLLCSGS SQAPYFKGTA VVNGEFKDLS. It is sometimes possible for the material contained within the vial of "PRDX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.