Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PPP3R2 expression in transfected 293T cell line by PPP3R2 polyclonal antibody. Lane 1: PPP3R2 transfected lysate (19.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PPP3R2 Polyclonal Antibody | anti-PPP3R2 antibody

PPP3R2 (CBLP, PPP3RL, Calcineurin Subunit B Type 2, Calcineurin B-like Protein, Calcineurin BII, PPP3R1-like, Protein Phosphatase 2B Regulatory Subunit 2, Protein Phosphatase 3 Regulatory Subunit B beta Isoform) APC

Gene Names
PPP3R2; PPP3RL
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPP3R2; Polyclonal Antibody; PPP3R2 (CBLP; PPP3RL; Calcineurin Subunit B Type 2; Calcineurin B-like Protein; Calcineurin BII; PPP3R1-like; Protein Phosphatase 2B Regulatory Subunit 2; Protein Phosphatase 3 Regulatory Subunit B beta Isoform) APC; anti-PPP3R2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PPP3R2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PPP3R2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PPP3R2, aa1-173 (NP_671709.1).
Immunogen Sequence
MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PPP3R2 expression in transfected 293T cell line by PPP3R2 polyclonal antibody. Lane 1: PPP3R2 transfected lysate (19.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PPP3R2 expression in transfected 293T cell line by PPP3R2 polyclonal antibody. Lane 1: PPP3R2 transfected lysate (19.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PPP3R2 antibody
PPP3R2 is regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. This protein confers calcium sensitivity (By similarity).
Product Categories/Family for anti-PPP3R2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,533 Da
NCBI Official Full Name
calcineurin subunit B type 2
NCBI Official Synonym Full Names
protein phosphatase 3, regulatory subunit B, beta
NCBI Official Symbol
PPP3R2
NCBI Official Synonym Symbols
PPP3RL
NCBI Protein Information
calcineurin subunit B type 2; CBLP; CNBII; calcineurin B, type II (19kDa); calcineurin B-like protein; calcineurin BII; protein phosphatase 2B regulatory subunit 2; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), beta isoform (calcineuri
UniProt Protein Name
Calcineurin subunit B type 2
Protein Family
UniProt Gene Name
PPP3R2
UniProt Synonym Gene Names
CBLP; PPP3RL; CBLP; CNBII
UniProt Entry Name
CANB2_HUMAN

Uniprot Description

PPP3R2: Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity. Belongs to the calcineurin regulatory subunit family.

Protein type: Protein phosphatase, regulatory subunit

Chromosomal Location of Human Ortholog: 9q31.1

Molecular Function: calcium ion binding

Research Articles on PPP3R2

Similar Products

Product Notes

The PPP3R2 ppp3r2 (Catalog #AAA6390484) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP3R2 (CBLP, PPP3RL, Calcineurin Subunit B Type 2, Calcineurin B-like Protein, Calcineurin BII, PPP3R1-like, Protein Phosphatase 2B Regulatory Subunit 2, Protein Phosphatase 3 Regulatory Subunit B beta Isoform) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP3R2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPP3R2 ppp3r2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP3R2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.