Western Blot (WB)
(Western Blot analysis of PPP2R3B expression in transfected 293T cell line by PPP2R3B MaxPab polyclonal antibody.Lane 1: PPP2R3B transfected lysate(24.86 KDa).Lane 2: Non-transfected lysate.)
Rabbit anti-Human PPP2R3B Polyclonal Antibody | anti-PPP2R3B antibody
PPP2R3B (Protein Phosphatase 2 (formerly 2A), Regulatory Subunit B'', beta, NY-REN-8, PPP2R3L, PPP2R3LY, PR48) (APC)
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
PPP2R3B; Polyclonal Antibody; PPP2R3B (Protein Phosphatase 2 (formerly 2A); Regulatory Subunit B''; beta; NY-REN-8; PPP2R3L; PPP2R3LY; PR48) (APC); Protein Phosphatase 2 (formerly 2A); PR48; anti-PPP2R3B antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PPP2R3B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
225
Applicable Applications for anti-PPP2R3B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PPP2R3B (AAH11180.1, 1aa-225aa) full-length human protein.
Immunogen Sequence
MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of PPP2R3B expression in transfected 293T cell line by PPP2R3B MaxPab polyclonal antibody.Lane 1: PPP2R3B transfected lysate(24.86 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PPP2R3B expression in transfected 293T cell line by PPP2R3B MaxPab polyclonal antibody.Lane 1: PPP2R3B transfected lysate(24.86 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(PPP2R3B MaxPab rabbit polyclonal antibody. Western Blot analysis of PPP2R3B expression in human placenta.)
Western Blot (WB)
(PPP2R3B MaxPab rabbit polyclonal antibody. Western Blot analysis of PPP2R3B expression in human placenta.)
Related Product Information for anti-PPP2R3B antibody
Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B''. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]
Product Categories/Family for anti-PPP2R3B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
PPP2R3B protein
Protein Family
Similar Products
Product Notes
The PPP2R3B (Catalog #AAA6451444) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP2R3B (Protein Phosphatase 2 (formerly 2A), Regulatory Subunit B'', beta, NY-REN-8, PPP2R3L, PPP2R3LY, PR48) (APC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP2R3B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPP2R3B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP2R3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
