Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PPP2R3B antibody (MBS5301279) used at 0.5 ug/ml to detect target protein.)

Rabbit PPP2R3B Polyclonal Antibody | anti-PPP2R3B antibody

PPP2R3B antibody

Gene Names
PPP2R3B; PR48; NYREN8; PPP2R3L; PPP2R3LY
Applications
Western Blot
Purity
Affinity purified
Synonyms
PPP2R3B; Polyclonal Antibody; PPP2R3B antibody; Polyclonal PPP2R3B; Anti-PPP2R3B; PPP2R; NY-REN-8; PR48; Protein Phosphatase 2 regulatory subunit B beta isoform; PPPR-2; PPPR 2; PPP2R3L; PPP2R3LY; anti-PPP2R3B antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP2R3B antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
255
Applicable Applications for anti-PPP2R3B antibody
Western Blot (WB)
Application Notes
WB: 0.5 ug/ml
Biological Significance
Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. PPP2R3B belongs to the B'' family. The B'' family has been further divided into subfamilies. PPP2R3B belongs to the beta subfamily of regulatory subunit B''.
Cross-Reactivity
Human
Immunogen
PPP2R3B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQ
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(PPP2R3B antibody (MBS5301279) used at 0.5 ug/ml to detect target protein.)

Western Blot (WB) (PPP2R3B antibody (MBS5301279) used at 0.5 ug/ml to detect target protein.)
Related Product Information for anti-PPP2R3B antibody
Rabbit polyclonal PPP2R3B antibody
Product Categories/Family for anti-PPP2R3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
65 kDa (MW of target protein)
NCBI Official Full Name
PPP2R3B protein, partial
NCBI Official Synonym Full Names
protein phosphatase 2, regulatory subunit B'', beta
NCBI Official Symbol
PPP2R3B
NCBI Official Synonym Symbols
PR48; NYREN8; PPP2R3L; PPP2R3LY
NCBI Protein Information
serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
UniProt Protein Name
Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
UniProt Gene Name
PPP2R3B
UniProt Synonym Gene Names
PPP2R3L
UniProt Entry Name
P2R3B_HUMAN

NCBI Description

Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B''. [provided by RefSeq, Apr 2010]

Uniprot Description

PPP2R3B: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein phosphatase, regulatory subunit; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: Xp22.33; Yp11.3

Cellular Component: nucleoplasm; protein phosphatase type 2A complex; nucleus

Molecular Function: protein binding; protein phosphatase type 2A regulator activity; calcium ion binding; protein serine/threonine phosphatase activity; phosphoprotein phosphatase activity

Biological Process: regulation of catalytic activity; mitotic cell cycle; cell cycle arrest; protein amino acid dephosphorylation; G1/S transition of mitotic cell cycle

Similar Products

Product Notes

The PPP2R3B ppp2r3b (Catalog #AAA5301279) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PPP2R3B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.5 ug/ml. Researchers should empirically determine the suitability of the PPP2R3B ppp2r3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP2R3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.