Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Ppp2r2c Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Lung)

Rabbit Ppp2r2c Polyclonal Antibody | anti-PPP2R2C antibody

Ppp2r2c antibody - N-terminal region

Gene Names
Ppp2r2c; PR52; IMYPNO; IMYPNO1; 6330548O06Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Ppp2r2c; Polyclonal Antibody; Ppp2r2c antibody - N-terminal region; anti-PPP2R2C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY
Sequence Length
447
Applicable Applications for anti-PPP2R2C antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Ppp2r2c Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Lung)

Western Blot (WB) (WB Suggested Anti-Ppp2r2c Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Lung)
Related Product Information for anti-PPP2R2C antibody
This is a rabbit polyclonal antibody against Ppp2r2c. It was validated on Western Blot

Target Description: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
Product Categories/Family for anti-PPP2R2C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform isoform 1
NCBI Official Synonym Full Names
protein phosphatase 2, regulatory subunit B, gamma
NCBI Official Symbol
Ppp2r2c
NCBI Official Synonym Symbols
PR52; IMYPNO; IMYPNO1; 6330548O06Rik
NCBI Protein Information
serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform
UniProt Protein Name
Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform
UniProt Gene Name
PPP2R2C
UniProt Entry Name
2ABG_HUMAN

Uniprot Description

PPP2R2C: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Belongs to the phosphatase 2A regulatory subunit B family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein phosphatase, regulatory subunit

Chromosomal Location of Human Ortholog: 4p16.1

Cellular Component: protein phosphatase type 2A complex

Molecular Function: protein binding; protein phosphatase type 2A regulator activity

Biological Process: regulation of catalytic activity; signal transduction

Similar Products

Product Notes

The PPP2R2C ppp2r2c (Catalog #AAA3213559) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ppp2r2c antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Ppp2r2c can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP2R2C ppp2r2c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VTEADVISTV EFNHTGELLA TGDKGGRVVI FQREPESKNA PHSQGEYDVY. It is sometimes possible for the material contained within the vial of "Ppp2r2c, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.